[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38071.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  23/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:217 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   119->142 PF02183 * HALZ 2.1e-06 41.7 24/45  
:BLT:SWISS 100->177 APGM_METVS 9e-06 29.5 %
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38071.1 GT:GENE ABE38071.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 934622..935275 GB:FROM 934622 GB:TO 935275 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE38071.1 GB:DB_XREF GI:91681769 LENGTH 217 SQ:AASEQ MTIRRSIIRIKGAPSVCGSTPMTLATLDAISARPASRLLRLAALPVMVALCGGGALAQSLPDSENGRYTFTPSAEGVMRLDTRTGKVSTCSDKGNGWACYVIADERAAFDAEIGRLQGDNDRLKKDADALKVENDSLKAQLAQRGPTVSGKIEESMPKSDKMATPEVITKDGQRKLEIPLPSDQDVDRVMGFIERAWRRLIEIANRIQRETTGDGKT GT:EXON 1|1-217:0| BL:SWS:NREP 1 BL:SWS:REP 100->177|APGM_METVS|9e-06|29.5|78/406| COIL:NAA 41 COIL:NSEG 1 COIL:REGION 104->144| SEG 31->45|sarpasrllrlaalp| HM:PFM:NREP 1 HM:PFM:REP 119->142|PF02183|2.1e-06|41.7|24/45|HALZ| OP:NHOMO 23 OP:NHOMOORG 23 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111111111-----------1--------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,144-171,210-218| PSIPRED cccEEEEEEEccccccccccccEEEHHHHHcccHHHHHHHHHHHHHHHHHHcccHHEEEcccccccEEEEEEccccEEEEEccccEEEEEEEccccEEEEEEccHHHHHHHHHHHcccccHHHHHHHHHHHccccHHHHHHHHccccccccHHHHccccccccccccEEccccEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccc //