[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38074.1
DDBJ      :             two component transcriptional regulator, LuxR family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  661/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
a.4.6c.23.1
:224 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   9->206 1yioA PDBj 6e-17 34.1 %
:RPS:PDB   1->50 1a2oA PDBj 2e-04 19.1 %
:RPS:PDB   32->207 3cwoX PDBj 4e-26 12.0 %
:RPS:SCOP  8->126 1ny5A1  c.23.1.1 * 1e-12 19.8 %
:RPS:SCOP  148->209 1yioA1  a.4.6.2 * 2e-15 41.9 %
:HMM:SCOP  1->138 1k66A_ c.23.1.1 * 1.1e-26 34.6 %
:HMM:SCOP  133->219 1p4wA_ a.4.6.2 * 5.2e-19 37.9 %
:RPS:PFM   9->121 PF00072 * Response_reg 3e-09 32.7 %
:RPS:PFM   153->206 PF00196 * GerE 1e-12 55.6 %
:HMM:PFM   10->121 PF00072 * Response_reg 1.5e-23 38.5 109/112  
:HMM:PFM   154->208 PF00196 * GerE 5e-21 43.6 55/58  
:BLT:SWISS 9->212 AGMR_PSEAE 2e-38 44.1 %
:PROS 169->196|PS00622|HTH_LUXR_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38074.1 GT:GENE ABE38074.1 GT:PRODUCT two component transcriptional regulator, LuxR family GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 937871..938545 GB:FROM 937871 GB:TO 938545 GB:DIRECTION + GB:PRODUCT two component transcriptional regulator, LuxR family GB:PROTEIN_ID ABE38074.1 GB:DB_XREF GI:91681772 InterPro:IPR000792 InterPro:IPR001789 InterPro:IPR013249 LENGTH 224 SQ:AASEQ MSTPVSTHLIIADDHPLFRDALRLAVSSVVPGAKVGEAGSFEDLTAMLERDGDVDLVLLDLKMPGISGFSGLIYLRAQYPAIPVVVVSASDDVETIRRSLDFGASGFVPKRFGVEKLGEAILQVLDGDVWVPPDVDLSAAADPETSKLRDRLVTLTPQQVRVLMMLSEGLLNKQIAYELGVSEATIKAHVSAILQKLGVESRTQAVIAAAKISGNQWRQDEPVA GT:EXON 1|1-224:0| BL:SWS:NREP 1 BL:SWS:REP 9->212|AGMR_PSEAE|2e-38|44.1|204/221| PROS 169->196|PS00622|HTH_LUXR_1|PDOC00542| SEG 51->61|dgdvdlvlldl| BL:PDB:NREP 1 BL:PDB:REP 9->206|1yioA|6e-17|34.1|185/198| RP:PDB:NREP 2 RP:PDB:REP 1->50|1a2oA|2e-04|19.1|47/347| RP:PDB:REP 32->207|3cwoX|4e-26|12.0|175/236| RP:PFM:NREP 2 RP:PFM:REP 9->121|PF00072|3e-09|32.7|110/111|Response_reg| RP:PFM:REP 153->206|PF00196|1e-12|55.6|54/57|GerE| HM:PFM:NREP 2 HM:PFM:REP 10->121|PF00072|1.5e-23|38.5|109/112|Response_reg| HM:PFM:REP 154->208|PF00196|5e-21|43.6|55/58|GerE| GO:PFM:NREP 7 GO:PFM GO:0000156|"GO:two-component response regulator activity"|PF00072|IPR001789| GO:PFM GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|PF00072|IPR001789| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00072|IPR001789| GO:PFM GO:0003700|"GO:transcription factor activity"|PF00196|IPR000792| GO:PFM GO:0005622|"GO:intracellular"|PF00196|IPR000792| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00196|IPR000792| GO:PFM GO:0043565|"GO:sequence-specific DNA binding"|PF00196|IPR000792| RP:SCP:NREP 2 RP:SCP:REP 8->126|1ny5A1|1e-12|19.8|116/137|c.23.1.1| RP:SCP:REP 148->209|1yioA1|2e-15|41.9|62/70|a.4.6.2| HM:SCP:REP 1->138|1k66A_|1.1e-26|34.6|136/149|c.23.1.1|1/1|CheY-like| HM:SCP:REP 133->219|1p4wA_|5.2e-19|37.9|87/0|a.4.6.2|1/1|C-terminal effector domain of the bipartite response regulators| OP:NHOMO 2980 OP:NHOMOORG 664 OP:PATTERN -------------------------------------------------------------------- 9BD3T4441111--43322-25--352222228666AECD576J9E644663654242--57C5PCHQVQ611114---3318-----------11---4---33C3E32--------------------------999AA555E5834633323---1--2114-9B8A1-------1----48512--23564444456526445547566254762324322222222B8333333333333333333321---22-1--111111121--1-11112223233221111222121211111111111113122222222161621111221-1-11--1---3-1--A111-74122123-21111---5-13--3-----15J564226456544344433334-67678A77588-755495A89599431-14227767335--------122--853------------------------------1562-43224A558775444266DE55561765A9AGH-29979B766678AB358-6714441111111-1384A2141-152-32--1-2-431432344443343------------------------1--641632745424545515555525436276---2323------83343637886765577-8777767777867567556444563427567777777577777666666661-666666566666--113433311111393311111211111-11122222211-132AAAA4C88867746977---------1334434444443449897A765561111112-111111--------2-------------------------------------3G- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2--2-----1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 221 STR:RPRED 98.7 SQ:SECSTR ccccEEEEEEEEcccHHHHHHHHHHHHTcTTEEEEEccccccTTHHHHHHHccccEEEEccEcTTccHHHHHHHHHHHcccccEEEEccccTHHHHHHHHHTTccEEEEcHHHHHcTHHHHHHHHHHTGGGEEEEEEEEEccccEEEEETTTTEEEEEEHHHHHHHHHHHTccEEEEEETTTTTccccccHHHHHHHGGGccccEEEHHHHTccEEEEEEE### DISOP:02AL 1-4,137-155,213-225| PSIPRED ccccccEEEEEEEccHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHHcccccEEEEEccccHHHHHHHHHccccEEEEccccHHHHHHHHHHHHcccccccHHHHHHHHHHHccccccccHHHccHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccccccccc //