[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38079.1
DDBJ      :             putative outer membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  49/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
f.4.1
:242 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   42->232 1bxwA PDBj 7e-05 19.0 %
:RPS:SCOP  46->232 1bxwA  f.4.1.1 * 1e-10 19.5 %
:HMM:SCOP  41->238 1g90A_ f.4.1.1 * 7.1e-31 33.1 %
:RPS:PFM   46->232 PF01389 * OmpA_membrane 6e-08 39.4 %
:HMM:PFM   47->233 PF01389 * OmpA_membrane 1.6e-08 24.1 170/200  
:HMM:PFM   2->65 PF02530 * Porin_2 0.00016 33.9 62/402  
:BLT:SWISS 60->232 OM31_BRUSU 1e-18 38.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38079.1 GT:GENE ABE38079.1 GT:PRODUCT putative outer membrane protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(947338..948066) GB:FROM 947338 GB:TO 948066 GB:DIRECTION - GB:PRODUCT putative outer membrane protein GB:PROTEIN_ID ABE38079.1 GB:DB_XREF GI:91681777 LENGTH 242 SQ:AASEQ MKKILLATVALVAFGAAPALAADLAARPYNKAPVYAPPVPIYNWTGFYIGGHIGGAFAGDNSIGTGVTANSDGKFLGGVQAGYDWQFAPSWVLGVEGQYSWLSGSNDAVAFTVVGQPGTYTFSDNQRGLASVTGRLGYTWGPALLYVKGGWAYADYKSSLTFTAPGGAAVGVSSTSSQDGYTVGAGLEYLFAQNWSGKIEYQYYDFGNVDLGAGFTAKNDQHVVKAGLNYRFNWGGPVVAKY GT:EXON 1|1-242:0| BL:SWS:NREP 1 BL:SWS:REP 60->232|OM31_BRUSU|1e-18|38.9|167/240| TM:NTM 1 TM:REGION 4->26| SEG 5->26|llatvalvafgaapalaadlaa| SEG 163->177|tapggaavgvsstss| RP:PDB:NREP 1 RP:PDB:REP 42->232|1bxwA|7e-05|19.0|168/172| RP:PFM:NREP 1 RP:PFM:REP 46->232|PF01389|6e-08|39.4|165/188|OmpA_membrane| HM:PFM:NREP 2 HM:PFM:REP 47->233|PF01389|1.6e-08|24.1|170/200|OmpA_membrane| HM:PFM:REP 2->65|PF02530|0.00016|33.9|62/402|Porin_2| GO:PFM:NREP 2 GO:PFM GO:0009279|"GO:cell outer membrane"|PF01389|IPR000498| GO:PFM GO:0016021|"GO:integral to membrane"|PF01389|IPR000498| RP:SCP:NREP 1 RP:SCP:REP 46->232|1bxwA|1e-10|19.5|164/172|f.4.1.1| HM:SCP:REP 41->238|1g90A_|7.1e-31|33.1|175/0|f.4.1.1|1/1|OMPA-like| OP:NHOMO 246 OP:NHOMOORG 50 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------25OGK687A79B944464663664---2---2836--322-2211211157-----11-----------------------------------------------------1----------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-11------------------------------------------------------------------ -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 179 STR:RPRED 74.0 SQ:SECSTR #########################################ccTTcEEEEEEEEEEcccccccccccccccccEEEEEEEEEEEEGGGGETTEEEEEEEEEEEEcccE##cGGGccccccccccEEEEEEEEEEEEEEEccccEEEEEEEEEEEEEEEccT########TTccEEEEEEEEEEEEEEEEEccccEEEEEEEEE##EccccccccccccccccEEEEEEEEEE########## DISOP:02AL 1-2| PSIPRED ccEEEEEHHHHHHHcccHHHHHHcccccccccccccccccccccccEEEEEEEEEEEccccccccccccccccEEEEEEEEEEEEEEcccEEEEEEEEEEEcccccccEEEccccccccEEEEEEEEEEEEEEEEEEEEEEccEEEEEEEEEEEEEccccEEEccccEEEEEEcccccccEEEEEEEEEEccccEEEEEEEEEEEccccccccccEEEEEEEEEEEEEEEEccccccEEEcc //