[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38083.1
DDBJ      :             periplasmic solute binding protein
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  449/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.92.2
:289 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   21->287 1xvlA PDBj 3e-35 32.3 %
:RPS:PDB   23->284 3cx3B PDBj 2e-44 19.9 %
:RPS:SCOP  20->288 1xvlA1  c.92.2.2 * 1e-67 27.6 %
:HMM:SCOP  22->289 1toaA_ c.92.2.2 * 2.4e-90 45.1 %
:RPS:PFM   4->287 PF01297 * SBP_bac_9 2e-44 37.3 %
:HMM:PFM   5->287 PF01297 * SBP_bac_9 7.1e-93 43.7 279/303  
:BLT:SWISS 8->288 MNTA_LISIN 6e-37 30.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38083.1 GT:GENE ABE38083.1 GT:PRODUCT periplasmic solute binding protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 950286..951155 GB:FROM 950286 GB:TO 951155 GB:DIRECTION + GB:PRODUCT periplasmic solute binding protein GB:PROTEIN_ID ABE38083.1 GB:DB_XREF GI:91681781 InterPro:IPR006127 InterPro:IPR006128 InterPro:IPR006129 LENGTH 289 SQ:AASEQ MFRIAIVIISLLVGAGAVRADDRIGVVASFSILGDFVRNVGGDRVAVTTLVGPTGDVHVYTPSPRDAKRVADARLVVVNGLGLEGWLPRLVQSSGGKATIVTATKGVKTRKLGSEADPHGWQSVTNAKVYVSNIRDALVAADPAGAAAYRANADAYLAKLDALDREVRDAAAKIPAAARKVISSHDAFGYFADSYDIAFIAPQGVSTESEVSARDVARIITQIRTSKIPAVFLENISDPRLIQRIAAETGARIGGTLYSDSLTAENGDAPTYIDMVRHNIRTLTSALAN GT:EXON 1|1-289:0| BL:SWS:NREP 1 BL:SWS:REP 8->288|MNTA_LISIN|6e-37|30.6|281/310| SEG 137->164|alvaadpagaaayranadaylakldald| SEG 170->178|aaakipaaa| BL:PDB:NREP 1 BL:PDB:REP 21->287|1xvlA|3e-35|32.3|266/279| RP:PDB:NREP 1 RP:PDB:REP 23->284|3cx3B|2e-44|19.9|251/255| RP:PFM:NREP 1 RP:PFM:REP 4->287|PF01297|2e-44|37.3|279/291|SBP_bac_9| HM:PFM:NREP 1 HM:PFM:REP 5->287|PF01297|7.1e-93|43.7|279/303|SBP_bac_9| GO:PFM:NREP 2 GO:PFM GO:0030001|"GO:metal ion transport"|PF01297|IPR006127| GO:PFM GO:0046872|"GO:metal ion binding"|PF01297|IPR006127| RP:SCP:NREP 1 RP:SCP:REP 20->288|1xvlA1|1e-67|27.6|268/279|c.92.2.2| HM:SCP:REP 22->289|1toaA_|2.4e-90|45.1|268/277|c.92.2.2|1/1|"Helical backbone" metal receptor| OP:NHOMO 567 OP:NHOMOORG 455 OP:PATTERN ----------------------------------------------111--11--------------3 ----2-3-111211-------1---1------211122221111111-2---2111-11122--211-1-21------21--1-------------1---------1-----------------111-1-1-11-122222---41122322211221111111112222111111111111131-1----11-11111-1111-1-1-111111-1-1--111-22222221111111111111111111112111331-21233--221-1-1-1-1222111111111111111111111111111111121----1111-11121111111111--11-111--1211--11332111-11-1111-11--1----222221111111111122----------1-11111211111122211112211112---112111111111111111-11-1-12-----------------------------------11111-------------11--------1---------11----1-111--1----111111111--112---21-----------21211-1-1------1----1-------------------11----1-----------------------------1-11-------4-12-22---1-122-------2-1-1--21------222221111111111111111111211111112-211111111111--1-------------1-1-1-1-111111111-----------------111------111---------11--1------------------------------------------22--------------------------------------1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 268 STR:RPRED 92.7 SQ:SECSTR ####################ccccEEEEccHHHHHHHHHHHGGGcEEEEEccccccTTTccccHHHHHHHHHccEEEEccTTTcGGGGTcccTTTTccccEEEccTTccccccccccccGGGcHHHHHHHHHHHHHHTTTccTTcTTEEHHHHHHHHHHHHHHHHHHHHHHHTTTccccEEEEcccccHHHHHHTTcEEEEcccccTTccccHHHHHHHHHHHHHHcccEEEEccccccccTTTHHHHcccEEEEccccccccccccccccHHHHHHHHHHHHTTTcc# DISOP:02AL 206-213,289-290| PSIPRED cHHHHHHHHHHHHHccccccccccEEEEEcHHHHHHHHHHcccEEEEEEEEcccccccEEcccHHHHHHHHHccEEEEEccccHHHHHHHHHHccccccEEEccccccccccccccccEEEEcHHHHHHHHHHHHHHHHHcccccHHHHHccHHHHHHHHHHHHHHHHHHHHccccccEEEEEEccHHHHHHHHcccEEEEEEcccccccccHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHcccEEEEEEEccccccccccccHHHHHHHHHHHHHHHHcc //