[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38087.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:112 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38087.1 GT:GENE ABE38087.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 954333..954671 GB:FROM 954333 GB:TO 954671 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE38087.1 GB:DB_XREF GI:91681785 LENGTH 112 SQ:AASEQ MTPIEKQSGLKRDLLLAGILIMAGVAMSGLSLTQVDNSGRLHLAQATQPLQSTPGADGKSSAPMDSTTTGARPHDIAPQPARPDSDALDAGAKPALPPAPAEKKGEPIQPKG GT:EXON 1|1-112:0| SEG 86->107|daldagakpalppapaekkgep| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7,46-75,78-80,84-86,97-113| PSIPRED ccccHHHHcHHHHHHHHHHHHHHHHHHcccEEEEEcccccEEEHHcccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccHHcccccccccc //