[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38092.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:52 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   18->45 PF03540 * TFIID_30kDa 4.5e-05 53.6 28/51  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38092.1 GT:GENE ABE38092.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(958083..958241) GB:FROM 958083 GB:TO 958241 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE38092.1 GB:DB_XREF GI:91681790 LENGTH 52 SQ:AASEQ MRFPRPTHRVFAPRAPDKSPRVTRLVLLVFVVKIAVDALRRRRARPAETEPA GT:EXON 1|1-52:0| TM:NTM 1 TM:REGION 18->39| SEG 25->32|lvllvfvv| SEG 35->51|avdalrrrrarpaetep| HM:PFM:NREP 1 HM:PFM:REP 18->45|PF03540|4.5e-05|53.6|28/51|TFIID_30kDa| OP:NHOMO OP:NHOMOORG 0 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,41-53| PSIPRED cccccccHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccc //