[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38101.1
DDBJ      :             protein of unknown function DUF107
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  65/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.40.12
:149 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   94->146 3cp0A PDBj 8e-10 24.5 %
:RPS:SCOP  93->146 2exdA1  b.40.12.1 * 5e-04 24.5 %
:HMM:PFM   13->147 PF01957 * NfeD 7.4e-31 29.7 128/144  
:BLT:SWISS 81->146 YBBJ_SHIFL 4e-09 36.4 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38101.1 GT:GENE ABE38101.1 GT:PRODUCT protein of unknown function DUF107 GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 967782..968231 GB:FROM 967782 GB:TO 968231 GB:DIRECTION + GB:PRODUCT protein of unknown function DUF107 GB:PROTEIN_ID ABE38101.1 GB:DB_XREF GI:91681799 InterPro:IPR002810 LENGTH 149 SQ:AASEQ MLDMLGALGPWNWLIIGFVLMALELLAPGIFLFWLGLAALLSGLAAFALHLSWQLQILLFALFAVAAVPLWRRMARGGAAESNATNPFLNRRADALVGRIFTLEKPIVDGVGTVRIDDTFWRVTGPDAPAGSRVKIVQADGVNLTVAGA GT:EXON 1|1-149:0| BL:SWS:NREP 1 BL:SWS:REP 81->146|YBBJ_SHIFL|4e-09|36.4|66/152| TM:NTM 3 TM:REGION 2->24| TM:REGION 28->50| TM:REGION 53->71| SEG 29->51|giflfwlglaallsglaafalhl| SEG 58->70|llfalfavaavpl| RP:PDB:NREP 1 RP:PDB:REP 94->146|3cp0A|8e-10|24.5|53/62| HM:PFM:NREP 1 HM:PFM:REP 13->147|PF01957|7.4e-31|29.7|128/144|NfeD| RP:SCP:NREP 1 RP:SCP:REP 93->146|2exdA1|5e-04|24.5|53/72|b.40.12.1| OP:NHOMO 65 OP:NHOMOORG 65 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-111111111111111111------1-111--11111111111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------1---------------------------------------------------------------------------------1---------1-------------------------------1111-1--1---------------------------1----11-11111111111----------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 53 STR:RPRED 35.6 SQ:SECSTR #############################################################################################GGGTTcEEEEEEcccccccEEEETTEEEEETTccccTTcEEEEEEEETTEEEE### DISOP:02AL 76-91| PSIPRED cHHHHHcccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEccccccccccccccccHHHEEEccEEEEEEEEEccEEEEEEccEEEEEEccccccccEEEEEEEcccEEEEEEc //