[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38110.1
DDBJ      :             heat shock protein Hsp20
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  248/915 : Eukaryota  2/199 : Viruses  2/175   --->[See Alignment]
b.15.1
:159 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   39->132 2byuA PDBj 3e-14 23.7 %
:RPS:SCOP  1->140 1gmeA  b.15.1.1 * 8e-18 23.2 %
:HMM:SCOP  5->141 1gmeA_ b.15.1.1 * 1.6e-20 27.0 %
:RPS:PFM   45->139 PF00011 * HSP20 3e-06 34.8 %
:HMM:PFM   43->140 PF00011 * HSP20 1e-18 30.5 95/102  
:BLT:SWISS 3->151 HSPB_BRAJA 3e-36 48.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38110.1 GT:GENE ABE38110.1 GT:PRODUCT heat shock protein Hsp20 GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 978190..978669 GB:FROM 978190 GB:TO 978669 GB:DIRECTION + GB:PRODUCT heat shock protein Hsp20 GB:PROTEIN_ID ABE38110.1 GB:DB_XREF GI:91681808 InterPro:IPR002068 LENGTH 159 SQ:AASEQ MRTFDLTPFYRSTIGFDRLFNLLDQTPGDAAAPGYPPYNIERTGENAYRISVAVSGFSSAELSIVSKENTLTIKGEKTANENGAKSEVLYRGIAARAFERAFQLADYVTVKNATLENGLLHVDLVREIPEAKKPRSIPISTTAASAPQVVDQSNAKAAA GT:EXON 1|1-159:0| BL:SWS:NREP 1 BL:SWS:REP 3->151|HSPB_BRAJA|3e-36|48.6|146/153| SEG 27->38|pgdaaapgyppy| RP:PDB:NREP 1 RP:PDB:REP 39->132|2byuA|3e-14|23.7|93/101| RP:PFM:NREP 1 RP:PFM:REP 45->139|PF00011|3e-06|34.8|92/101|HSP20| HM:PFM:NREP 1 HM:PFM:REP 43->140|PF00011|1e-18|30.5|95/102|HSP20| RP:SCP:NREP 1 RP:SCP:REP 1->140|1gmeA|8e-18|23.2|138/150|b.15.1.1| HM:SCP:REP 5->141|1gmeA_|1.6e-20|27.0|137/0|b.15.1.1|1/1|HSP20-like chaperones| OP:NHOMO 501 OP:NHOMOORG 252 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------222512222317334632222222222221223-3633345324212442445354332211122322222222222222223332222-----------------------------121131-------------------------------------------------11--1----------------------------------------------------------------------------22-1-21112-1111111111111111111----------11122332212222222222-222222222222222222234422---3332333333333323222222221-22222222222211-1-----1111-1--1---------------------1---3211111111111111111----------22121111111111------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------1------------------------- -----1------------------1------------------------------------------------------------------------------------------------------------------------------------------------------ STR:NPRED 154 STR:RPRED 96.9 SQ:SECSTR HTccccEEHHHHHHHHHHHHHHHHTccccTTGGGGGcEEEEEccccEEEEEEEcTTccGGGEEEEETTTEEEEEEccccccccTTccccccccccccEEEEEEccccccGGGEEEETTEEEEEEEcccccccccccccccccc##TTEEEcTTTcc### DISOP:02AL 74-88,129-160| PSIPRED cccccccccccccccHHHHHHHHHHccccccccccccccEEEEcccEEEEEEEEccccHHHEEEEEEccEEEEEEEEcccccccccEEEEEEEEEEEEEEEEEcccccEEEEEEEEccEEEEEEEcccccccccEEEEEEEccccccEEcccccccccc //