[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38111.1
DDBJ      :             protein of unknown function DUF81
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  16/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:339 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:HMM:PFM   88->334 PF01925 * TauE 1.9e-29 32.2 233/239  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38111.1 GT:GENE ABE38111.1 GT:PRODUCT protein of unknown function DUF81 GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 978727..979746 GB:FROM 978727 GB:TO 979746 GB:DIRECTION + GB:PRODUCT protein of unknown function DUF81 GB:PROTEIN_ID ABE38111.1 GB:DB_XREF GI:91681809 InterPro:IPR002781 LENGTH 339 SQ:AASEQ MLAVSFGWLGRNREGRWLNSAHGLCQSSCWPGLGRSLRFRTARPAGTRPAGSIVKPAATTDRGYPNSHESAVMSEVFDSPPRSKPVAFGAGALIGALGGLIGLGGAEFRLPLLISLFRFRGLDAVILNKAVSLVVVATALPFRASAVPLADVAGEWPIILNLLAGSLAGAWIGAGWATRLQSQTLYRIIAVLLVAIAGVLLFAHDVVAGAPLFSGAALLLAGVIAGFVIGVIASLLGVAGGEFLIPTLVLLFGADIKLAGSLSLAVSLPTMLVGFARYSLDDSFSVIGLNKAFLLVMAAGSIVGTLIGGLLLGQVPNAVLLPALAAILLISAAKVWRHA GT:EXON 1|1-339:0| TM:NTM 8 TM:REGION 86->106| TM:REGION 114->136| TM:REGION 157->179| TM:REGION 183->205| TM:REGION 209->231| TM:REGION 236->258| TM:REGION 287->309| TM:REGION 314->336| SEG 89->106|gagaligalggliglgga| SEG 188->201|iiavllvaiagvll| SEG 216->221|aallla| SEG 304->313|gtligglllg| SEG 320->333|llpalaaillisaa| HM:PFM:NREP 1 HM:PFM:REP 88->334|PF01925|1.9e-29|32.2|233/239|TauE| OP:NHOMO 19 OP:NHOMOORG 17 OP:PATTERN ---------------------------------------------------1---------------- ---------------------------------------1--------------------------------------------------------------------------------------1-11-11------1---------111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1---------------1-----------------------3-------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 53 STR:RPRED 15.6 SQ:SECSTR ##################################################################################################################################EEEEEEEEccccHHH###HHHHTTTTTTHHHHHHHHHHTcccccHHHHHHHHHHHH######################################################################################################################################################### DISOP:02AL 1-1,339-340| PSIPRED ccEEEEEcccccccccccHHHHHHHHccccccccccEEEEEcccccccccccEEcccccccccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccEEEEHHHHHHHHHHHHHHHHHHHccHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHccHHHHHHHHHccHHHHHHHHHHcccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccc //