[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38124.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  130/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:344 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   36->306 PF03706 * UPF0104 3e-06 28.4 %
:HMM:PFM   36->306 PF03706 * UPF0104 6.4e-18 24.7 263/294  
:BLT:SWISS 59->277 Y712_SYNY3 1e-23 30.7 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38124.1 GT:GENE ABE38124.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 998619..999653 GB:FROM 998619 GB:TO 999653 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE38124.1 GB:DB_XREF GI:91681822 LENGTH 344 SQ:AASEQ MVAAIGRVIAHLREKQILHKLGVAISIAVIAAACYVLFHLLRGIDVDKVLEAIRQTEPRLIGLAALFVAAGYFTLTFYDLFALRTIGRNDVPYHIAALAAFTSYSIGHNVGASVFTGGAVRYRIYSAWGLDGIDVAKICFLAGLTFWLGNAAVLGMGIAYHPEAASSIDQLPPWLNRVLALVILAGLMVYVIWMSIKPRSVGRGTWTVELPGGPLTMLQIGIGIIDLGFCALAMYVLVPDEPNLGFVVVAVIFVSATLLGFASHSPGGLGVFDAAMLVGLWQMDKEALLAGMLLFRLLYYIVPFMLSVIILAIREIVLGARLKRMHRLADALDPKPIRQDPTPG GT:EXON 1|1-344:0| BL:SWS:NREP 1 BL:SWS:REP 59->277|Y712_SYNY3|1e-23|30.7|215/322| TM:NTM 8 TM:REGION 19->41| TM:REGION 61->83| TM:REGION 110->132| TM:REGION 136->158| TM:REGION 173->195| TM:REGION 216->238| TM:REGION 244->264| TM:REGION 294->316| SEG 23->33|vaisiaviaaa| SEG 288->298|llagmllfrll| RP:PFM:NREP 1 RP:PFM:REP 36->306|PF03706|3e-06|28.4|268/291|UPF0104| HM:PFM:NREP 1 HM:PFM:REP 36->306|PF03706|6.4e-18|24.7|263/294|UPF0104| OP:NHOMO 192 OP:NHOMOORG 133 OP:PATTERN --------------------------------------------------111--------------- --------------------------------------------1------------------------------------------------------------------------------------------------------21-331----------11--1-1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1----11111222332222222222222222222-2222222221--12222232223311------1-11---11111111-1111-22-------------------------------12-------------1----11------------1--------1---------------------------------1-----1--1111---------11-1-------------------------------------------1111---111----------------------1-----------------------------------111----------------------------------------------------------------------------------1--111-------12----1111------------------------1-1-1-11111111----------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,323-323,326-345| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHccccEEEEccEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHccccccccccccc //