[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38146.1
DDBJ      :             multi antimicrobial extrusion protein MatE
Swiss-Prot:             

Homologs  Archaea  28/68 : Bacteria  192/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
:483 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   60->191 PF01554 * MatE 4e-06 27.3 %
:RPS:PFM   274->436 PF01554 * MatE 2e-06 27.7 %
:HMM:PFM   56->206 PF01554 * MatE 8.4e-19 24.7 150/162  
:HMM:PFM   283->425 PF01554 * MatE 3.3e-23 21.7 143/162  
:BLT:SWISS 41->418 NORM_THEMA 1e-19 20.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38146.1 GT:GENE ABE38146.1 GT:PRODUCT multi antimicrobial extrusion protein MatE GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 1023877..1025328 GB:FROM 1023877 GB:TO 1025328 GB:DIRECTION + GB:PRODUCT multi antimicrobial extrusion protein MatE GB:PROTEIN_ID ABE38146.1 GB:DB_XREF GI:91681844 InterPro:IPR002528 LENGTH 483 SQ:AASEQ MSDIAVAELPPVEDEPRRRPAAEPPPPPNNPLLDDAILPTLLRLSWPNMVALTAGTCVAVAETSYIGRLGTESLAAMALVFPFVILTMTMSGGAMGGGVASAIARALGSGDSDRAATLAMHALLIGLCFGFAFMLGMLIFGARALELLGGRGNVLTQAIGYVHIFFAGAMVPWLMNTFAAILRGTGNMKLPSLMILNAAVLQIVLGGVLGLGLGPIPSFGMQGVAAGTLIAFSIGTAVMAWYIFSGRARVTPKFKGLRIQRGMFFDILKVGAVACFSPLQSVLTITIFTHMLAHFGTEVLAGYGIGARLEFMLTSIAFAIGIASVPMIGMAIGARQVKRARQIAWTAGLVSFASVGVVGCVIAFFPDLWVDLFTKDPAVRLASERYLQAAAPMYAFIGLSISMYFSSQGAAKVLGPVLAQTGRLIFIGIGGWLLTVNHGTAGNFFTLAAASMVLLGVTSALSVLLTRWEPKVVPVVDPRSSLS GT:EXON 1|1-483:0| BL:SWS:NREP 1 BL:SWS:REP 41->418|NORM_THEMA|1e-19|20.3|370/464| TM:NTM 12 TM:REGION 38->60| TM:REGION 70->92| TM:REGION 118->140| TM:REGION 156->178| TM:REGION 192->214| TM:REGION 225->247| TM:REGION 270->292| TM:REGION 311->333| TM:REGION 346->368| TM:REGION 385->407| TM:REGION 413->435| TM:REGION 450->472| SEG 9->36|lppvedeprrrpaaepppppnnplldda| SEG 87->102|tmtmsggamgggvasa| SEG 141->152|garalellggrg| SEG 200->214|vlqivlggvlglglg| RP:PFM:NREP 2 RP:PFM:REP 60->191|PF01554|4e-06|27.3|131/161|MatE| RP:PFM:REP 274->436|PF01554|2e-06|27.7|155/161|MatE| HM:PFM:NREP 2 HM:PFM:REP 56->206|PF01554|8.4e-19|24.7|150/162|MatE| HM:PFM:REP 283->425|PF01554|3.3e-23|21.7|143/162|MatE| GO:PFM:NREP 10 GO:PFM GO:0006855|"GO:drug transmembrane transport"|PF01554|IPR002528| GO:PFM GO:0015238|"GO:drug transmembrane transporter activity"|PF01554|IPR002528| GO:PFM GO:0015297|"GO:antiporter activity"|PF01554|IPR002528| GO:PFM GO:0016020|"GO:membrane"|PF01554|IPR002528| GO:PFM GO:0055085|"GO:transmembrane transport"|PF01554|IPR002528| GO:PFM GO:0006855|"GO:drug transmembrane transport"|PF01554|IPR002528| GO:PFM GO:0015238|"GO:drug transmembrane transporter activity"|PF01554|IPR002528| GO:PFM GO:0015297|"GO:antiporter activity"|PF01554|IPR002528| GO:PFM GO:0016020|"GO:membrane"|PF01554|IPR002528| GO:PFM GO:0055085|"GO:transmembrane transport"|PF01554|IPR002528| OP:NHOMO 339 OP:NHOMOORG 223 OP:PATTERN 112-2-------------------2223132-1------1-2---111-1134-2423223------- --1--------------------------------------------------------------------------------1111-111113-------2--121--1---------------------------1111-----2-----------------------1------------------1---------1-12--11---111-1--1----1--111111-2--------------------------------------------11------------------------------1--------------222-3333333122-2--1---122--111--22---235--121-12-1-----1-------323---2-222------------1-11-1-1-----------1----1---1-------1-----------------------------------------------12---------------------------------1111-111------2-1-1------------11-11------11--------1----2-21211-2----3-11-----------1--------11-----11-11-112111122111-122112111-1----1--------1--1------1-11----------------------------111-------------------------------------------------------1--------------------------1-----1----------------------2231--1-33222---1-11----------611-------1--1-----------------------------2222221212--2 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------2---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,12-30,481-484| PSIPRED ccccHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHcHHHccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHccHHHHcc //