[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38150.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:221 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38150.1 GT:GENE ABE38150.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(1028726..1029391) GB:FROM 1028726 GB:TO 1029391 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE38150.1 GB:DB_XREF GI:91681848 LENGTH 221 SQ:AASEQ MLELSILAVIALAAVYWTALWLMGRQEDVLYGSFVTPSNVTTSNQSVSSIQPCAPLHRDFPPELPRLPRAALPAPTTTQPATTPPTTTAQAPRPSSVAPLRPAALTPPAPPAATTIDLAAMATQANAGIRPQPAADSPAPPKPIVIREAQPVDRAAQFPAPPAAPPLMMAQPKQPLAVNPAAVQRGMMAPEAQATHQPQRTDVLASLLETIKRDLNEAARK GT:EXON 1|1-221:0| TM:NTM 1 TM:REGION 2->24| SEG 6->15|ilavialaav| SEG 38->51|snvttsnqsvssiq| SEG 61->94|ppelprlpraalpaptttqpattpptttaqaprp| SEG 98->120|aplrpaaltppappaattidlaa| SEG 155->176|aaqfpappaapplmmaqpkqpl| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,85-96,128-138,192-196,216-222| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHccccccEEEcccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEHHHHHHHHcccccccccccccccccccEEEEccccHHHHHcccccccccccHHccccccccccHHHHHHHcccccHHHccccHHHHHHHHHHHHHHHHHHHHHHc //