[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38155.1
DDBJ      :             alpha amylase, catalytic region
Swiss-Prot:             

Homologs  Archaea  26/68 : Bacteria  608/915 : Eukaryota  137/199 : Viruses  0/175   --->[See Alignment]
b.71.1c.1.8
:542 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   9->495 1zjbA PDBj 1e-87 40.0 %
:RPS:PDB   7->537 3czkA PDBj 4e-63 21.4 %
:RPS:SCOP  7->440 1m53A2  c.1.8.1 * 5e-81 38.2 %
:RPS:SCOP  460->533 1m53A1  b.71.1.1 * 1e-08 26.0 %
:HMM:SCOP  7->457 1m53A2 c.1.8.1 * 1.4e-139 47.8 %
:HMM:SCOP  460->534 1smaA2 b.71.1.1 * 8.3e-08 33.8 %
:RPS:PFM   39->212,325->369 PF00128 * Alpha-amylase 6e-44 56.8 %
:HMM:PFM   32->373 PF00128 * Alpha-amylase 1.1e-94 45.4 302/316  
:HMM:PFM   432->509 PF11941 * DUF3459 2.9e-07 33.3 75/115  
:BLT:SWISS 9->489 AGLA_RHIME e-102 41.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38155.1 GT:GENE ABE38155.1 GT:PRODUCT alpha amylase, catalytic region GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 1034576..1036204 GB:FROM 1034576 GB:TO 1036204 GB:DIRECTION + GB:PRODUCT alpha amylase, catalytic region GB:PROTEIN_ID ABE38155.1 GB:DB_XREF GI:91681853 InterPro:IPR006047 InterPro:IPR006589 LENGTH 542 SQ:AASEQ MDNVVSPSWWAAGVLYQIYPRSFQDSDADGIGDLRGIIDRLDYLSDLGVDAIWLSPIFPSPMADFGYDVADYVGIDPIFGSMADFDALMITAHARGLKVILDLVPNHSSDQHPWFVESRASRDNPKRDWYLWRDPAPGGGPPTNWLSEFGGSAWDYDEATGQYYYHAFLAQQPDLNWRNPQVRAAIYDAMRFWLRKGVDGFRVDVIWHLIKDDMFRDNPPNPEFSPDMPPHAALLPVYSVDRPETLEIVAEMRAVLDEFDQRLLIGEIYLPIERLVAYYGADTQGRLQGAQLPFNFALLSTPWRAPAIAALIARYEAALPEGAWPNWVLGNHDRPRVASRVGEAQARVAAMLLLTLRGTPTLYYGDELGMTQVAIAPQDVRDPFEKNVPGIGVGRDGCRTPMQWDASANAGFSDARPWLPLAPDAAPDNVANLRADAQSILNLYRALLRLRRRLPQLAQGAYQPLAAEGDLLLYRRHDQGQSVLVALNLGADPVSVGSDAFGLDGEVLLSTFMDRAGERIGATLDLRGDEGVIVGRAPEPVV GT:EXON 1|1-542:0| BL:SWS:NREP 1 BL:SWS:REP 9->489|AGLA_RHIME|e-102|41.5|479/551| SEG 304->320|rapaiaaliaryeaalp| SEG 414->428|darpwlplapdaapd| SEG 441->457|lnlyrallrlrrrlpql| BL:PDB:NREP 1 BL:PDB:REP 9->495|1zjbA|1e-87|40.0|472/556| RP:PDB:NREP 1 RP:PDB:REP 7->537|3czkA|4e-63|21.4|495/618| RP:PFM:NREP 1 RP:PFM:REP 39->212,325->369|PF00128|6e-44|56.8|207/296|Alpha-amylase| HM:PFM:NREP 2 HM:PFM:REP 32->373|PF00128|1.1e-94|45.4|302/316|Alpha-amylase| HM:PFM:REP 432->509|PF11941|2.9e-07|33.3|75/115|DUF3459| GO:PFM:NREP 3 GO:PFM GO:0003824|"GO:catalytic activity"|PF00128|IPR006047| GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF00128|IPR006047| GO:PFM GO:0043169|"GO:cation binding"|PF00128|IPR006047| RP:SCP:NREP 2 RP:SCP:REP 7->440|1m53A2|5e-81|38.2|421/478|c.1.8.1| RP:SCP:REP 460->533|1m53A1|1e-08|26.0|73/78|b.71.1.1| HM:SCP:REP 7->457|1m53A2|1.4e-139|47.8|437/478|c.1.8.1|1/1|(Trans)glycosidases| HM:SCP:REP 460->534|1smaA2|8.3e-08|33.8|74/0|b.71.1.1|1/1|Glycosyl hydrolase domain| OP:NHOMO 2240 OP:NHOMOORG 771 OP:PATTERN --1-1--1222222212-------3--5213-------------------21---2-232-111---- 35128132222-2-13322-23--332222223444113314224352334158A314--1143513764244333432--13-----2221-4-----513-255166----------------121221112-256566---9248B322111--24223311-43451-21----2--1-8773412-273555555553555545244415554654-378455454-342222222222222211132452-5811525AA2257252442655222433322223333433232422224444222223311-333231-152222222727-422-4445-13--28-111-1--61-134231-2--33331-----1233111-33332------------21511424424-2225652564332142322-434411---------1---2-42------------------------------32-2--1-11111-111111111141-111-111111---1114-1-----15---122-21---------1322-1-1--111-------211-221-15515231----------------------------5545-32-4362322223-222-21-2--3---2---------35--2213333333333-33333334333333333333432111-3214233333233342322133321-222222222222-------------1-714---141--------1----------4A11311212311115111---------1133422222355552123233-11------11221111--------1-5----1---1-3-----21--31---467233144523- --11122-------1645525556352-------------------1233587834222222-12-2441--3-5575A7-2222532-3-2423241431-1--1--216321132211112222252EP7-53512-212231111--22121112224638548BCHG2233---3A---1---1-41---1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 542 STR:RPRED 100.0 SQ:SECSTR TTcTTcHHHccTTGGGcTTccEEEEcHHHHHccHHHHHHTHHHHHHHTccEEEEcccEEEcccccTTcEEEEEEEcTTTccHHHHHHHHHHHHHTTcEEEEEccccEEETTcHHHHHHHTTcHHHHTTccEEcccHHHHHHcccccTTTccccEEEETTTTEEEEccccTTEEEccTTcHHHHHHHHHHHHHHHHTTccEEEETTTTcccccTTcccHHHHHTTcccEEEEEcccccTTcccHHHHHHHHHHHHHHHHHcTTEEEEcccccGGGcGGGGccGGGTTcccccEEEcHHHHHHHHHHHHHTcTHHHHHHHHTcccEEEEEccccccEEGGGGHHHHHTcccccccccHHHHHHHHHTccTTcccccEEEccccEEHHHHHHHHHHHHHccEEEEEETTGGGTcccTTTcGGGGGcccccHHHHHTTccTTcHHHHHHHHHHHHHHHTcGGGcTTccEEccTTEEEEEEEccTTTEEEEEEcccccEEEcGGGTTcccEEccccccTccEEEccccEEEcTTcEEEEEccTTccc DISOP:02AL 1-1,541-543| PSIPRED ccccccHHHHccccEEEEEccHHccccccccccHHHHHHHHHHHHHccccEEEEcccccccccccccccccccccccccccHHHHHHHHHHHHHcccEEEEEEcccccccccHHHHHHHcccccccccEEEEccccccccccccccccccccccccccccccEEEccccccccccccccHHHHHHHHHHHHHHHHccccEEEEccHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHHccccccccccccEEEcHHHHccccccHHHHHHHHHHHHHcccccccEEEEcccccHHHHHHccHHHHHHHHHHHHHccccEEEEccccccccccccccHHcccHHHHHHHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHccccHHHHHHHHHHHHHHccEEEccEEEEEEccccEEEEEEEEccEEEEEEEEcccccEEEEccccccccEEEEcccccccccccccEEEEccccEEEEEccccccc //