[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38159.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:152 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   45->136 PF07480 * DUF1520 9e-08 42.0 %
:HMM:PFM   45->138 PF07480 * DUF1520 2e-12 27.8 90/94  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38159.1 GT:GENE ABE38159.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 1039866..1040324 GB:FROM 1039866 GB:TO 1040324 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE38159.1 GB:DB_XREF GI:91681857 LENGTH 152 SQ:AASEQ MRTTITSLATAAVLIGSVTIGPAMARDRSDRVELTASQLTDQAAARVAQLKADLRLTPDQDKNWSGVQAELVNVWTKQGENRQSWRNARANQAGSVDLIEQMRKDGDDRIERGNDLKRLADAAQPLYASLDDQQKRRFGEALFQRSRDRRSD GT:EXON 1|1-152:0| RP:PFM:NREP 1 RP:PFM:REP 45->136|PF07480|9e-08|42.0|88/93|DUF1520| HM:PFM:NREP 1 HM:PFM:REP 45->138|PF07480|2e-12|27.8|90/94|DUF1520| OP:NHOMO 17 OP:NHOMOORG 11 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------21211---12222------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,34-34,145-145,147-153| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHccccHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccc //