[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38172.1
DDBJ      :             protein of unknown function DUF1428
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  110/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.58.4
:118 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->116 2okqA PDBj 6e-25 47.8 %
:RPS:SCOP  1->116 2okqA1  d.58.4.18 * 5e-20 47.8 %
:RPS:PFM   2->105 PF07237 * DUF1428 5e-20 55.3 %
:HMM:PFM   2->105 PF07237 * DUF1428 1.3e-44 53.4 103/103  
:BLT:SWISS 1->116 YBAA_SHIFL 2e-24 47.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38172.1 GT:GENE ABE38172.1 GT:PRODUCT protein of unknown function DUF1428 GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(1050754..1051110) GB:FROM 1050754 GB:TO 1051110 GB:DIRECTION - GB:PRODUCT protein of unknown function DUF1428 GB:PROTEIN_ID ABE38172.1 GB:DB_XREF GI:91681870 InterPro:IPR009874 LENGTH 118 SQ:AASEQ MSYVDGFVLPVPKAKLADYVKLARKAGKVFREHGALDYREWIADDVEPGKVTSFPRSVKLKPDEVVVFSYIVYKSRKQRDRVMAKAMQDPRLDGMDPKTMPFDAKRMFFGGFKALVKA GT:EXON 1|1-118:0| BL:SWS:NREP 1 BL:SWS:REP 1->116|YBAA_SHIFL|2e-24|47.8|115/117| BL:PDB:NREP 1 BL:PDB:REP 1->116|2okqA|6e-25|47.8|115/127| RP:PFM:NREP 1 RP:PFM:REP 2->105|PF07237|5e-20|55.3|103/103|DUF1428| HM:PFM:NREP 1 HM:PFM:REP 2->105|PF07237|1.3e-44|53.4|103/103|DUF1428| RP:SCP:NREP 1 RP:SCP:REP 1->116|2okqA1|5e-20|47.8|115/117|d.58.4.18| OP:NHOMO 121 OP:NHOMOORG 113 OP:PATTERN --------------------------------------------1-------1--------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1-----1121---1--111----------1------2--122-1-----111121--111-111111-----------------1-------------------------------1-11--1111--------------1---------1-1------11-111---1-----------------1-----1--------------------------111---------------------------------11--1-------1---11---------------------1----1-1111111111-1111111111111111111------------------------11111111-----------------2------1---------------------------------1------1----------------------------------2211111----------------------------------------------------------------1- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 115 STR:RPRED 97.5 SQ:SECSTR ccEEEEEEEEEEGGGHHHHHHHHHHHHHHHHHTTccEEEEEEcccccccccccHHHHTTccTTEEEEEEEEEEccHHHHHHHHHHHHTcHHHHHTT#ccccccTTTcEEEEEEccc## PSIPRED cccccEEEEEccHHHHHHHHHHHHHHHHHHHHHcccEEEEEEccccccccEEcHHHHHccccccEEEEEEEEcccHHHHHHHHHHHHccccccccccccccccHHHHHHccHHHHHHc //