[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38185.1
DDBJ      :             ChaC-like protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  179/915 : Eukaryota  84/199 : Viruses  0/175   --->[See Alignment]
d.269.1
:192 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   15->182 3cryB PDBj 9e-25 11.9 %
:RPS:SCOP  18->161 1vkbA  d.269.1.1 * 4e-23 17.8 %
:HMM:SCOP  16->131 1xhsA_ d.269.1.1 * 2.7e-14 33.7 %
:RPS:PFM   16->187 PF04752 * ChaC 2e-27 41.5 %
:HMM:PFM   16->185 PF04752 * ChaC 4.3e-47 39.6 169/177  
:BLT:SWISS 13->180 CHAC_ECOLI 7e-23 32.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38185.1 GT:GENE ABE38185.1 GT:PRODUCT ChaC-like protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(1063575..1064153) GB:FROM 1063575 GB:TO 1064153 GB:DIRECTION - GB:PRODUCT ChaC-like protein GB:PROTEIN_ID ABE38185.1 GB:DB_XREF GI:91681883 InterPro:IPR006840 LENGTH 192 SQ:AASEQ MSAKTLSDSELAEGDLWVFGYGSLMWSPGFAFVEQAPARLIGEHRALCVYSFVHRGTPEHPGLVLGLDRGGACRGIAFRVAEEHRMQTVAYLREREQVTSVYREVKRSVWLEDDARRRVSAMAYVVDRGHAQYAGRLTPAEQLRLVRQGHGRSGANRDYVLATVRSLEAQGCRDPQLHRLAEGLRDETPPQR GT:EXON 1|1-192:0| BL:SWS:NREP 1 BL:SWS:REP 13->180|CHAC_ECOLI|7e-23|32.5|166/231| RP:PDB:NREP 1 RP:PDB:REP 15->182|3cryB|9e-25|11.9|159/169| RP:PFM:NREP 1 RP:PFM:REP 16->187|PF04752|2e-27|41.5|171/173|ChaC| HM:PFM:NREP 1 HM:PFM:REP 16->185|PF04752|4.3e-47|39.6|169/177|ChaC| RP:SCP:NREP 1 RP:SCP:REP 18->161|1vkbA|4e-23|17.8|135/147|d.269.1.1| HM:SCP:REP 16->131|1xhsA_|2.7e-14|33.7|98/0|d.269.1.1|1/1|BtrG-like| OP:NHOMO 374 OP:NHOMOORG 263 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------11------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-----112111111111111111111112-11211211131-11122222132112---1131111111-------------212-----------------------------------222221111111111111211111112121111--11111112111-2----------------------------------------------------1---------------------------------1--1---------------------------1-------1111-111111111111-111111111111111111111111-------------------111111111-----------------------------1--------------------------------1111-1111-111------------------------------------------------------------------------------------------------- ----1---------1----------------------------------------------1------------------------11-------------2-11--1--334241-2111121221223G2-2221-1122112-2-21211212222-12112--52111121111-7111114293-32---111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 168 STR:RPRED 87.5 SQ:SECSTR ############ccEEEEEEccGGGcHHHHHcEEEEEEEEEEEEEEEEEETTcccTTTcccEEEEEEEEEEEEEEEEEEEEGGGHHHHHHHHHHTTTTTTccEEEEEEEEETT##ccEEEEEEEEcccEEEcEEEccccHHHHHHHHHHHHHTTccHHHHHHTcccccccccccHHHHHHHH########## DISOP:02AL 1-4,7-7,185-185,187-193| PSIPRED cccccccccccccccEEEEEEEcccccccccccccccEEEEccccccEEccccccccccccEEEEEEccccEEEEEEEEEccccHHHHHHHHHHcccccccEEEEEEEEEEcccccccEEEEEEEEccccccccccccHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHccccc //