[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38198.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  33/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:189 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   9->165 PF10649 * DUF2478 1e-29 45.9 %
:HMM:PFM   9->165 PF10649 * DUF2478 4.5e-55 42.0 157/159  
:BLT:SWISS 9->173 MODC2_BRAJA 2e-23 33.9 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38198.1 GT:GENE ABE38198.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 1087300..1087869 GB:FROM 1087300 GB:TO 1087869 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABE38198.1 GB:DB_XREF GI:91681896 LENGTH 189 SQ:AASEQ MTFDSQCEVAALVYDRGDDPDGVLQAFAADLNARGYRSVGLVQFGHRQADAPRLSARLVHNGEELPLYQDLGLQATGCALDPGRLLDAGARVASAMEQGADLLIINRFGQHESEGQGLLHLIVQALSADIPLVIAVPSHRFDAWIRFADGMSVRLRCDRQVLDAWWSTLHGRVGRRAARAHTTMCEVYK GT:EXON 1|1-189:0| BL:SWS:NREP 1 BL:SWS:REP 9->173|MODC2_BRAJA|2e-23|33.9|165/897| SEG 175->180|rraara| RP:PFM:NREP 1 RP:PFM:REP 9->165|PF10649|1e-29|45.9|157/159|DUF2478| HM:PFM:NREP 1 HM:PFM:REP 9->165|PF10649|4.5e-55|42.0|157/159|DUF2478| OP:NHOMO 54 OP:NHOMOORG 33 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------112322-33433----------1-1-1---------------------11---1-31111-11-------------312---------------------------------------1---------------------------1----------1------------------------111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED ccccccccEEEEEccccccHHHHHHHHHHHHHHcccEEEEEEEccccccccccEEEEEEccccEEEEccccccccccccccHHHHHHHHHHHHHHHHccccEEEEccccHHHHcccccHHHHHHHHHccccEEEEEccHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc //