[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38204.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  12/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:204 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   76->193 PF10649 * DUF2478 4e-14 38.1 %
:HMM:PFM   11->193 PF10649 * DUF2478 6.8e-54 44.7 159/159  
:BLT:SWISS 77->195 MODC2_BRAJA 9e-10 33.6 %
:PROS 105->120|PS00012|PHOSPHOPANTETHEINE
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38204.1 GT:GENE ABE38204.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 1093118..1093732 GB:FROM 1093118 GB:TO 1093732 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE38204.1 GB:DB_XREF GI:91681902 InterPro:IPR006162 LENGTH 204 SQ:AASEQ MSFESNQSMAIAAVRGGPGTPAADVLTAFALRRKAEGVVIVGVIVPPEETGLRQHGAGHGAGHGEGHGEGHGGGHDGCECRSELLDVATGDRYAMHQNLGSGSQACNLNSSSLALAAGAVERAIASNPELVVLSRFGGQEAQHGGLMSAFQAAVAAGVPVACVVTPKAEAVWQDFAQGLSISLPPDAEALEAWWRGHARGRNAA GT:EXON 1|1-204:0| BL:SWS:NREP 1 BL:SWS:REP 77->195|MODC2_BRAJA|9e-10|33.6|119/100| PROS 105->120|PS00012|PHOSPHOPANTETHEINE|PDOC00012| SEG 36->49|egvvivgvivppee| SEG 55->75|hgaghgaghgeghgeghgggh| SEG 107->117|nlnssslalaa| SEG 152->164|aavaagvpvacvv| RP:PFM:NREP 1 RP:PFM:REP 76->193|PF10649|4e-14|38.1|118/159|DUF2478| HM:PFM:NREP 1 HM:PFM:REP 11->193|PF10649|6.8e-54|44.7|159/159|DUF2478| OP:NHOMO 15 OP:NHOMOORG 12 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-12---2-211------------1------------------------1--------------------------1---------------------------------------------------------------------------------------------------------11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7,58-70,202-205| PSIPRED ccccccccEEEEEEEccccccHHHHHHHHHHHHHcccEEEEEEEEcccccccccccccccccccccccccccccccccccccEEEEEccccEEEEEccccccccccccccHHHHHHHHHHHHHHHccccEEEEccccHHHHcccccHHHHHHHHHccccEEEEEcHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHcc //