[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38213.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  52/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.38.1
:257 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   35->243 3cjyA PDBj 3e-12 15.5 %
:RPS:SCOP  40->115 1z54A1  d.38.1.1 * 9e-06 14.5 %
:HMM:SCOP  33->108 1yocA1 d.38.1.5 * 9.5e-07 28.4 %
:HMM:PFM   48->89 PF03061 * 4HBT 6.2e-07 38.1 42/79  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38213.1 GT:GENE ABE38213.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(1105259..1106032) GB:FROM 1105259 GB:TO 1106032 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE38213.1 GB:DB_XREF GI:91681911 LENGTH 257 SQ:AASEQ MDAIYRIDGNAIETSGHAAGPWDPSMQHGSPPSALVAHIAEQMPAPAPMHVVRVTVDLLRPVPVGPLTFDTEVLREGRKIQLCAVRLLSNGVVVVNATVLKVRNAPPDLPDHIEHPALDVPLPDDCPPLDVSFIGNPFVGGMSLRKVHGGFGSIGPGATWYRADRPLIEGQPTSQLMRAVIASDFSNATSAVLDFRHWIFINADLNVFLARQPVGDWILLNSEMWLGPDGAGTASSRLADVQGYFGRAIQNLVIEQR GT:EXON 1|1-257:0| SEG 118->131|ldvplpddcppldv| RP:PDB:NREP 1 RP:PDB:REP 35->243|3cjyA|3e-12|15.5|200/249| HM:PFM:NREP 1 HM:PFM:REP 48->89|PF03061|6.2e-07|38.1|42/79|4HBT| RP:SCP:NREP 1 RP:SCP:REP 40->115|1z54A1|9e-06|14.5|76/132|d.38.1.1| HM:SCP:REP 33->108|1yocA1|9.5e-07|28.4|74/0|d.38.1.5|1/1|Thioesterase/thiol ester dehydrase-isomerase| OP:NHOMO 76 OP:NHOMOORG 52 OP:PATTERN -------------------------------------------------------------------- ---11------1--142----3--22-----133432121-----1-1----111111----1-113-1-1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------3-------211---11111--------------------------------------------------1-------------------------------------------------------------------------------------------------1--------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111--11---------------------------------------------1----------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 244 STR:RPRED 94.9 SQ:SECSTR #cEEEEEETTEEEEEEEEEEcccGGGcccTTTHHHHHHHHHHHHHHHTccEEEEEEEEcccccTTEEEEEEEEEEEccccEEEEEEEEETTEEEEEEEEEEccTTccccccccccccccGGGcccccccccccTTccTGGGEEEEEcccTTccTTEEEEEEEEETTcccccHHHHHHHTTHHHHHHHHGGGGTccHTcccEEcEEEEEEccccccccEEEEEEEEEEETTEEEEEEEEEcTTccE############ DISOP:02AL 1-1,257-258| PSIPRED cccEEEEEcccEEEcccccccccHHHHccccHHHHHHHHHHHHccccccEEEEEEEEEccccccccEEEEEEEEEcccEEEEEEEEEEEccEEEEEEEEEEEEcccccccccccccccccccccccccEEccccccccEEEEEEEEcccccccccccEEEEEccccccccccccHHHHHHHHHccccccccccccHHcccccccEEEEEEEcccccEEEEEEEEEEcccccEEEEEEEEEcccccEEEEEEEEEccc //