[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38222.1
DDBJ      :             amidohydrolase 2
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  130/915 : Eukaryota  39/199 : Viruses  0/175   --->[See Alignment]
c.1.9
:327 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   32->325 2qahA PDBj e-100 57.5 %
:RPS:PDB   50->321 3cjpA PDBj 4e-16 16.9 %
:RPS:SCOP  48->322 2ffiA1  c.1.9.15 * 2e-79 31.1 %
:HMM:SCOP  46->321 2ffiA1 c.1.9.15 * 3e-75 42.5 %
:RPS:PFM   261->321 PF04909 * Amidohydro_2 6e-04 43.9 %
:HMM:PFM   50->321 PF04909 * Amidohydro_2 3.1e-45 27.6 254/270  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38222.1 GT:GENE ABE38222.1 GT:PRODUCT amidohydrolase 2 GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(1111929..1112912) GB:FROM 1111929 GB:TO 1112912 GB:DIRECTION - GB:PRODUCT amidohydrolase 2 GB:PROTEIN_ID ABE38222.1 GB:DB_XREF GI:91681920 InterPro:IPR006992 LENGTH 327 SQ:AASEQ MLADPHPTPPRKGEGRRKRSLSMQFEKTPGWLDWYQGPSKPRFKAPAGAVDAHCHVFGPGAEFPFAPERKYTPCDASKRQLTALRDHLGFARNVVVQATCHGADNSAMIDALVSSGGRARGVATVKRSVSDAELQAMHDSGVRGVRFNFVKRLVDFTPKDELVEIAERIKQLGWHVVIYFEAVDLPELWDFFTALPTTVVVDHMGRPDVTEPVDGEEFELFVRLMREHGNVWSKVSCPERLSVSGPPALHGEQRAYRDVVPFARRIVESFPDRVLWGTDWPHPNLKDHMPDDGLLVDLIPQIAPTAELQRKLLVDNPMRLYWPEEQS GT:EXON 1|1-327:0| BL:PDB:NREP 1 BL:PDB:REP 32->325|2qahA|e-100|57.5|285/294| RP:PDB:NREP 1 RP:PDB:REP 50->321|3cjpA|4e-16|16.9|237/262| RP:PFM:NREP 1 RP:PFM:REP 261->321|PF04909|6e-04|43.9|57/259|Amidohydro_2| HM:PFM:NREP 1 HM:PFM:REP 50->321|PF04909|3.1e-45|27.6|254/270|Amidohydro_2| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF04909|IPR006992| GO:PFM GO:0008152|"GO:metabolic process"|PF04909|IPR006992| RP:SCP:NREP 1 RP:SCP:REP 48->322|2ffiA1|2e-79|31.1|264/271|c.1.9.15| HM:SCP:REP 46->321|2ffiA1|3e-75|42.5|266/0|c.1.9.15|1/1|Metallo-dependent hydrolases| OP:NHOMO 280 OP:NHOMOORG 169 OP:PATTERN -------------------------------------------------------------------- --1-----11--------------1-----------1-11----1--------11-----------1--------------------------------------------------------------------------------------------------------------------------------------------------1---1---1----------------------------------------------------------------------------------------------------------------------------------------------------------2----------753---22111--------------4--3-53---211---131---51---1---------11111111-----1---------------------------------1----3316-224211222222242221132-4131---2211-1--635154--------------------1----------------111---1--------------------------------------------11----------------------------------------------------------------------1------------------------1----------11111-11111----111111111---22---------------11111------------21--1233-122------------------------------------------------------------------------------------------------- ---------------111-1111442111111111-1111-11111----1224--------1-----------------------------1---111-----------------------------------------------------------------------1-----------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 295 STR:RPRED 90.2 SQ:SECSTR ###############################cccccccccccccGGGccEEEEEEccccHHHHHHHHHHHTccEcccGGGcccHHHHHHHHHHHHHHHTTccTHHHHHHHHHHHcTTTEEEEEcccTTccHHHHHHTTTTTccEEEEEcccTTcGGGGHHHHHHHHHTcccEEEcccTTccHHHHHHHHHHHHHcTTcEEEGGGGGGGHHHHHHHHTTccHHHHHHHcTTEEEEcTTcccHHHTTcTTcTTTccHHHHHHHHHHHHHHHcTTTEEccccTTcccHHHHGTcccTHHHHHHHHcccHHHHHHHHTHHHHHHHccccc# DISOP:02AL 1-6,8-18,326-328| PSIPRED ccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEcccHHcccccccccccccccHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHccccEEEEEEccccccHHHHHHHHHccccEEEEcccccccccccHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHHHHccccEEEEcccccccccccccccHHHHHHHHHHcccEEEEEEEccccccccccccccccccHHHHHHHHHHHHHHcccEEEEcccccccccccccccHHHHHHHHHHHcccHHHHHHHHcccHHHHHcccccc //