[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38239.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:84 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   22->39 PF10642 * Tom5 0.00014 38.9 18/49  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38239.1 GT:GENE ABE38239.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 1131912..1132166 GB:FROM 1131912 GB:TO 1132166 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE38239.1 GB:DB_XREF GI:91681937 LENGTH 84 SQ:AASEQ MFTFSGLPYDANMPAIVWALYLVAAVLYCSPMTIGFIRNVEYKWPLYFGNLLAGWTGIGWAYCLYYAIFADREHAPSQPVALAA GT:EXON 1|1-84:0| TM:NTM 2 TM:REGION 16->38| TM:REGION 47->69| HM:PFM:NREP 1 HM:PFM:REP 22->39|PF10642|0.00014|38.9|18/49|Tom5| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,78-85| PSIPRED cccccccccccccHHHHHHHHHHHHHHHHccccEEEEEcccEEccEEEHHHHHcccHHHHHHHHHHHHHHcHHHcccccccccc //