[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38248.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:228 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38248.1 GT:GENE ABE38248.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 1146560..1147246 GB:FROM 1146560 GB:TO 1147246 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABE38248.1 GB:DB_XREF GI:91681946 LENGTH 228 SQ:AASEQ MGRRSRRGRDGDLTSINDLHIIKPRGSPLSISRDVGFRCHDECARDGRHHVVVAIADRGTRAPREPSNDAGQPSFKALTLPVRRFGVQYPMPSIRTKSRRHQLPQRASPLSTRRTFRGAVATLVRLAGAADAFAVEAEAPAVPAGVVALGAELADTGSDFAGASLLPVAVLAASVFDVATPCASVPRLTGAAIVSLLATAPCVAETCVTASAAMKPAAVMVRRVRCRE GT:EXON 1|1-228:0| SEG 2->12|grrsrrgrdgd| SEG 126->155|lagaadafaveaeapavpagvvalgaelad| SEG 161->175|agasllpvavlaasv| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-11,60-73,96-109,227-229| PSIPRED ccccccccccccccccccEEEEcccccccEEEcccccccHHHHHHcccEEEEEEEEcccccccccccccccccccEEEEEHHHHHcccccccccccHHHHHHcccccccccHHHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHcccHHHHHHHcHHHccccHHHEEEEEEccc //