[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38257.1
DDBJ      :             maleylacetoacetate isomerase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  210/915 : Eukaryota  121/199 : Viruses  0/175   --->[See Alignment]
a.45.1c.47.1
:218 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   12->217 2v6kA PDBj 5e-45 47.1 %
:RPS:PDB   12->203 3einA PDBj 5e-27 21.1 %
:RPS:SCOP  1->92 1t1vA  c.47.1.14 * 3e-18 16.3 %
:RPS:SCOP  90->211 1a0fA1  a.45.1.1 * 4e-13 15.8 %
:HMM:SCOP  10->98 1jlwA2 c.47.1.5 * 1.7e-21 41.6 %
:HMM:SCOP  89->218 1e6bA1 a.45.1.1 * 8.6e-27 31.8 %
:RPS:PFM   21->81 PF02798 * GST_N 6e-08 45.9 %
:HMM:PFM   13->83 PF02798 * GST_N 3.4e-10 33.3 69/75  
:HMM:PFM   139->197 PF00043 * GST_C 7.2e-07 28.6 49/95  
:BLT:SWISS 11->217 MAAI_VIBCH 5e-52 47.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38257.1 GT:GENE ABE38257.1 GT:PRODUCT maleylacetoacetate isomerase GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 1157973..1158629 GB:FROM 1157973 GB:TO 1158629 GB:DIRECTION + GB:PRODUCT maleylacetoacetate isomerase GB:PROTEIN_ID ABE38257.1 GB:DB_XREF GI:91681955 InterPro:IPR004045 InterPro:IPR005955 LENGTH 218 SQ:AASEQ MSKAADHEAAVLYGYFRSSAAYRVRIALNLKGIIVAQRYVHLRNGEQNLEAFRWINPAGLVPYWREGDFGLAQSLAIIEYLDEAHPEPPLLPKDARARAIVREIAYAVCCDIHPVGNLRVLKRLTELGVDEIDRARWSKEWIEQGFAAIEARLAQTPGPFAYGAQPTLADLCIVPQLFNARRFDADLAPFERIRQIEAEAMKLEAFVAAEPGRQPDAE GT:EXON 1|1-218:0| BL:SWS:NREP 1 BL:SWS:REP 11->217|MAAI_VIBCH|5e-52|47.3|207/215| BL:PDB:NREP 1 BL:PDB:REP 12->217|2v6kA|5e-45|47.1|206/214| RP:PDB:NREP 1 RP:PDB:REP 12->203|3einA|5e-27|21.1|185/207| RP:PFM:NREP 1 RP:PFM:REP 21->81|PF02798|6e-08|45.9|61/71|GST_N| HM:PFM:NREP 2 HM:PFM:REP 13->83|PF02798|3.4e-10|33.3|69/75|GST_N| HM:PFM:REP 139->197|PF00043|7.2e-07|28.6|49/95|GST_C| RP:SCP:NREP 2 RP:SCP:REP 1->92|1t1vA|3e-18|16.3|92/93|c.47.1.14| RP:SCP:REP 90->211|1a0fA1|4e-13|15.8|114/121|a.45.1.1| HM:SCP:REP 10->98|1jlwA2|1.7e-21|41.6|89/90|c.47.1.5|1/1|Thioredoxin-like| HM:SCP:REP 89->218|1e6bA1|8.6e-27|31.8|129/133|a.45.1.1|1/1|Glutathione S-transferase (GST), C-terminal domain| OP:NHOMO 455 OP:NHOMOORG 331 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------1---------2--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1221-----1-1122-11-11-------------11111231231-2---22122211-1211-12----111--------------1-------------------------------1141-211121222211111122111111113141331-121221211332-11--1----1-----------12-1-----------------------111112-----------------------------11-1--1112-1111111111111111111---1---------1-------11-----1--1---------1----------------1-11111111111111-------------------------1-----1111--1-2---------------111111--121-4434212121111111--------------111111111111111111111--------11----------------------------------------------------- ----111-----11-1-1-11121211111111111111111111111111111-1-----------------------------------------------211-1122211211111-1112-1115C3--14111111111-111-11-111111-1111112411233131--------21453-421132211 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 218 STR:RPRED 100.0 SQ:SECSTR cEEEEEEcccEEEEcTTcHHHHHHHHHHHHHTcccEEEEccGGGTGGGcHHHHTTcTTccccEEEETTEEEEcHHHHHHHHHHHHcccTTccccHHHHHHHHHHHHHHHTHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHTTTTcccccccccccHHHHHHHHHHHHHHHTTccGGGcHHHHHHHHHHHHHHHHHHHHHHHccccG DISOP:02AL 1-6,8-10,214-219| PSIPRED cccccccccEEEEEccccHHHHHHHHHHHHcccccEEEEccccccccccHHHHHccccccccEEEEccEEEEEHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccEEccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHccHHHHHHccccccccc //