[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38283.1
DDBJ      :             Twin-arginine translocation pathway signal
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  309/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
c.93.1
:407 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   48->381 1qnlA PDBj 5e-22 27.8 %
:RPS:PDB   46->395 3eafA PDBj 7e-35 15.7 %
:RPS:SCOP  46->368 1usgA  c.93.1.1 * 3e-41 19.6 %
:HMM:SCOP  45->395 1qo0A_ c.93.1.1 * 5.2e-75 30.7 %
:RPS:PFM   67->238 PF01094 * ANF_receptor 1e-14 35.5 %
:HMM:PFM   66->264 PF01094 * ANF_receptor 6.5e-08 17.9 195/348  
:HMM:PFM   1->17 PF10399 * UCR_Fe-S_N 0.00054 41.2 17/41  
:BLT:SWISS 48->332 AMIC_PSEAE 4e-21 29.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38283.1 GT:GENE ABE38283.1 GT:PRODUCT Twin-arginine translocation pathway signal GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 1198041..1199264 GB:FROM 1198041 GB:TO 1199264 GB:DIRECTION + GB:PRODUCT Twin-arginine translocation pathway signal GB:PROTEIN_ID ABE38283.1 GB:DB_XREF GI:91681981 InterPro:IPR000709 InterPro:IPR006311 LENGTH 407 SQ:AASEQ MSSDSPHNLTRRRFLSNFAFASTGLATGVGSWVVRPDWANAAAGAIKVGIATDLTGPMGYAGNADANVAKMVLKQINDAGGLLGRPLELYIEDTASNEAVAVGNVRKLIQRDKVDLVLGGITSSMRNAIKDVIVARGKTLYIYPQLYEGKECTPNLFCTGPTPAQQCDEFIPWLIKNGGKKFALPSANYVWPHTLNVYARKVIEANGGEVVLEEYYPLDQIDFSSTVNRIISNKVDVVFNTVIPPGVGPFFKQLYEAGFLKNGGRLACVYYDENTLGINQPAEIEGLASCLDYFKAVAKTDPVSAKIQAEYDKAYPGNFLFAAGSAATGTYRGLKLWEAAVKEAGKIDRDGVATAMDHAKITDGPGGPAEMVPGKRHCKMNMYTAVAKNGSYEIIARSNGLVDPKEC GT:EXON 1|1-407:0| BL:SWS:NREP 1 BL:SWS:REP 48->332|AMIC_PSEAE|4e-21|29.3|280/385| BL:PDB:NREP 1 BL:PDB:REP 48->381|1qnlA|5e-22|27.8|324/368| RP:PDB:NREP 1 RP:PDB:REP 46->395|3eafA|7e-35|15.7|343/379| RP:PFM:NREP 1 RP:PFM:REP 67->238|PF01094|1e-14|35.5|166/319|ANF_receptor| HM:PFM:NREP 2 HM:PFM:REP 66->264|PF01094|6.5e-08|17.9|195/348|ANF_receptor| HM:PFM:REP 1->17|PF10399|0.00054|41.2|17/41|UCR_Fe-S_N| RP:SCP:NREP 1 RP:SCP:REP 46->368|1usgA|3e-41|19.6|311/345|c.93.1.1| HM:SCP:REP 45->395|1qo0A_|5.2e-75|30.7|345/0|c.93.1.1|1/1|Periplasmic binding protein-like I| OP:NHOMO 829 OP:NHOMOORG 316 OP:PATTERN ----------------------1-1---1--2--------------------------------1--- ----1--2112----------2---2------211123211-----------1---------3-11-2--1----1----------------1------------11------------------------------111----112-12--111--211111111-111111-11111-1-1111--11----11111--1-1-1----1-----11-1-----------11----------------------------------------------------------------------------------------------11111111-1-----------1--2---1-12----------11-2------------12OMJ--3B6HB511111111114-57C42E5E-2--955334486533861--2-433443-3222222223---1511-----------------------------------3875835658322222229633332345B3734124434353358B37B-21-2-1-----------1243-3211-21-4122112222132-1--1--2141---------------------------11132----1-----------------12----1-1------1121-11------------------------------11111-------------------2---------111111111111------------112231---------------------1-1--222221111422332423----------------------11----------------2---------------------------------------------2--------3- --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 355 STR:RPRED 87.2 SQ:SECSTR ########################################EEEEEEEEEEEEccccTTHHHHHHHHHHHHHHHHHHHHHcEEcccEEEEEEEEcTTcHHHHHHHHHHHHHTTcccEEEEccHHHHHHHHHccHHHHHTcEEEEccccGGGTTcTTEEcccccHHHHHHHHHHHHHHHHccEEEEEcTTcHHHHTTHHHHHHHTGGGTEEEEEEEEccTTccHHHHHHHHHHTTcccEEEEcccHHHHHEHHHHHHHHTGcccEEEEcGGGccTTHHHHHcGGGTTcEEEEEccccGGcTTcHHHHHHHHHHHTTccGGGcccccHHHHHHHHHHHHHHHHHTTccHHTHHHHHHHHHHcccccTccccccccTTcccccccEEEEEcTTccEEEE############ DISOP:02AL 1-10,406-408| PSIPRED ccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEEcccccHHHHHHHHHHHHHccccEEEEccccHHHHHHHHHHHHHcccEEEEEEccccccccccEEEEEcccHHHHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHHHHHHHccccEEEEEEEccccccHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHccccccEEEEEEEcccHHHHccccHHHHccEEEEEccccccccccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHccccccccEEEEEEcccccccccEEEEEEEcccEEEEEEccccccccccc //