[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38292.1
DDBJ      :             ribulose 1,5-bisphosphate carboxylase large subunit
Swiss-Prot:RBL2_RHOPS   RecName: Full=Ribulose bisphosphate carboxylase;         Short=RuBisCO;         EC=4.1.1.39;

Homologs  Archaea  26/68 : Bacteria  126/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
c.1.14d.58.9
:461 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->456 9rubB PDBj 0.0 72.5 %
:RPS:PDB   6->441 1bwvA PDBj e-100 28.2 %
:RPS:SCOP  5->138 1rbaA2  d.58.9.1 * 3e-35 84.0 %
:RPS:SCOP  139->442 1rbaA1  c.1.14.1 * 3e-87 69.4 %
:HMM:SCOP  2->138 5rubA2 d.58.9.1 * 3.4e-47 44.9 %
:HMM:SCOP  139->458 5rubA1 c.1.14.1 * 3.4e-119 43.4 %
:RPS:PFM   24->135 PF02788 * RuBisCO_large_N 7e-07 35.0 %
:RPS:PFM   152->390 PF00016 * RuBisCO_large 9e-27 36.3 %
:HMM:PFM   144->452 PF00016 * RuBisCO_large 7.2e-113 37.3 300/309  
:HMM:PFM   10->135 PF02788 * RuBisCO_large_N 4.2e-45 47.5 118/126  
:BLT:SWISS 1->461 RBL2_RHOPS 0.0 100.0 %
:PROS 187->195|PS00157|RUBISCO_LARGE
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38292.1 GT:GENE ABE38292.1 GT:PRODUCT ribulose 1,5-bisphosphate carboxylase large subunit GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 1208614..1209999 GB:FROM 1208614 GB:TO 1209999 GB:DIRECTION + GB:PRODUCT ribulose 1,5-bisphosphate carboxylase large subunit GB:PROTEIN_ID ABE38292.1 GB:DB_XREF GI:91681990 InterPro:IPR000685 LENGTH 461 SQ:AASEQ MDQSNRYANLNLKESDLIAGGRHVLCAYIMKPKAGFGNFVETAAHFAAESSTGTNVEVSTTDDFTRGVDALVYEVDEAKELMKIAYPIELFDRNVIDGRAMIASFLTLTIGNNQGMGDVEYAKMHDFYVPPAYLRLFDGPSTTIKDLWRVLGRPVVDGGFIVGTIIKPKLGLRPQPFADACYDFWLGGDFIKNDEPQGNQVFAPFKDTVRAVNDAMRRAQDATGQPKLFSFNITADDHYEMLARGEYILETFGENADHVAFLVDGYVAGPAAVTTARRAFPKQYLHYHRAGHGAVTSPQSKRGYTAFVLSKMARLQGASGIHVGTMGYGKMEGEASDRDSAFMITQDSAEGPYFKQEWLGMNPTTPIISGGMNALRMPGFFANLGHSNLIMTAGGGAFGHIDGGAAGARSLRQAEQCWKQGADPVAFAKDHREFARAFESFPNDADKLYPNWRNMLKLAAA GT:EXON 1|1-461:0| SW:ID RBL2_RHOPS SW:DE RecName: Full=Ribulose bisphosphate carboxylase; Short=RuBisCO; EC=4.1.1.39; SW:GN Name=cbbM; OrderedLocusNames=RPD_1054; SW:KW Calvin cycle; Carbon dioxide fixation; Complete proteome; Lyase;Magnesium; Metal-binding; Monooxygenase; Oxidoreductase;Photosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->461|RBL2_RHOPS|0.0|100.0|461/461| GO:SWS:NREP 8 GO:SWS GO:0019253|"GO:reductive pentose-phosphate cycle"|Calvin cycle| GO:SWS GO:0015977|"GO:carbon fixation"|Carbon dioxide fixation| GO:SWS GO:0016829|"GO:lyase activity"|Lyase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0004497|"GO:monooxygenase activity"|Monooxygenase| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| GO:SWS GO:0015979|"GO:photosynthesis"|Photosynthesis| PROS 187->195|PS00157|RUBISCO_LARGE|PDOC00142| SEG 393->408|agggafghidggaaga| BL:PDB:NREP 1 BL:PDB:REP 2->456|9rubB|0.0|72.5|454/458| RP:PDB:NREP 1 RP:PDB:REP 6->441|1bwvA|e-100|28.2|415/471| RP:PFM:NREP 2 RP:PFM:REP 24->135|PF02788|7e-07|35.0|100/123|RuBisCO_large_N| RP:PFM:REP 152->390|PF00016|9e-27|36.3|223/292|RuBisCO_large| HM:PFM:NREP 2 HM:PFM:REP 144->452|PF00016|7.2e-113|37.3|300/309|RuBisCO_large| HM:PFM:REP 10->135|PF02788|4.2e-45|47.5|118/126|RuBisCO_large_N| GO:PFM:NREP 7 GO:PFM GO:0000287|"GO:magnesium ion binding"|PF02788|IPR017444| GO:PFM GO:0015977|"GO:carbon fixation"|PF02788|IPR017444| GO:PFM GO:0016984|"GO:ribulose-bisphosphate carboxylase activity"|PF02788|IPR017444| GO:PFM GO:0000287|"GO:magnesium ion binding"|PF00016|IPR000685| GO:PFM GO:0009536|"GO:plastid"|PF00016|IPR000685| GO:PFM GO:0015977|"GO:carbon fixation"|PF00016|IPR000685| GO:PFM GO:0016984|"GO:ribulose-bisphosphate carboxylase activity"|PF00016|IPR000685| RP:SCP:NREP 2 RP:SCP:REP 5->138|1rbaA2|3e-35|84.0|125/125|d.58.9.1| RP:SCP:REP 139->442|1rbaA1|3e-87|69.4|294/294|c.1.14.1| HM:SCP:REP 2->138|5rubA2|3.4e-47|44.9|136/0|d.58.9.1|1/1|RuBisCO, large subunit, small (N-terminal) domain| HM:SCP:REP 139->458|5rubA1|3.4e-119|43.4|320/0|c.1.14.1|1/1|RuBisCo, C-terminal domain| OP:NHOMO 205 OP:NHOMOORG 157 OP:PATTERN --1-11----------1------2---1---1---11------1111111111-1111111------- ---1------------------------------------------------11-----------------------------------------------------1-1---------------11111111111---------11111111111111111111111111111111111111-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------112332-32433----------1---1--2---1--1---1121112212----112323-----------2----121------------------------------------1---1------------11--------21-21-----12---11212---12------------111--1---------------------------------------------------------33---------------------------------1111------------------------------------------------------------------------------------------------------1--11--------------------------------------1--------------3----------------------------11--------------------------------------------------1---1-- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------1---52---1------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 455 STR:RPRED 98.7 SQ:SECSTR #cccccTcccccccTTccccTTcEEEEEEEEEcTTcccHHHHHHHHHHHTTcccGGGGGTTHHHHccEEEEEEEEEEETTEEEEEEcGGGccTTGcccTTcHHHHHHHHTccGGGcTTEEEEEEEEEEccHHHHTTccccccHHHHHHHHHTHHHcccccEEEccccccccccHHHHHHHHHHHHHHTccEEccTTccccTTccHHHHHHHHHHHHHHHHHHHTcccEEEEEcccccHHHHHHHHHHHHHTTcHHHHHcEEEEEGGGcHHHHHHHHHHHHHTTcEEEEcTTTHHHHHccTTcEEcHHHHHHHHHHHTccEEEccccccccccccHHHHHHccEEcccTTTTccccEEcTTccccEEEEEccccTTcHHHHHHHHcccccEEEccHHHHTcTTcHHHHHHHHHHHHHHHHHHHHTHHHHHHcHHHHHHHHHHcHHHHHHTHHHHHHH##### DISOP:02AL 1-4,460-462| PSIPRED ccccHHHcccccccccccccccEEEEEEEEEcccccccHHHHccccccccccccEEEccccccHHHHcccEEEEcccccccccEEEHHHHccccccccccHHHHHHHHHHccccccccccccEEEEEEccHHHHHccccccccHHHHHHHcccccccccEEEEEEEcccccccHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHHccccEEEEEEEEcccccHHHHHHHHHHccccEEEEEccccccccccccccccccHHHHHHHHHHccccEEccccccccccccccccEEEHHHcccHHcccccccccccccccccEEccccccHHHHHHHHHHHcccEEEEEcccccccccccccHHHHHHHHHHHHHHccccHHHHHHHcHHHHHHHHHcccHHHHHcHHHHHHHccccc //