[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38297.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  82/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.55.1
:284 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  188->237 1e4fT1  c.55.1.1 * 4e-04 28.0 %
:BLT:SWISS 1->266 YQEB_ECOLI 2e-29 31.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38297.1 GT:GENE ABE38297.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(1213345..1214199) GB:FROM 1213345 GB:TO 1214199 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE38297.1 GB:DB_XREF GI:91681995 LENGTH 284 SQ:AASEQ MHQPTDLSRRRFAIVLGTSEIASAVAVHLHRDGYGVVMSHDPFPPVIRRKMAFHDALYGDQVSVDGIAGERADDGVQILKALRYSPAVQVSWLSLTDLLPVGSVDVLVDARMQKQRITPDLRRLAGLTIGLGPGFSTRINCDVAIETRPGRSGLVVTQGWTDAADGVANPLGDAGAERFQYSQASGRWHTAVEIGSRVFKGFMLGHLSGDAVRAPCDGIVRGIVRDGCEVPGKVKLLEIDPRGRHAQWTGIDGRGRTIANAVCRAIAAHAPSQTDHDVGPFQPV GT:EXON 1|1-284:0| BL:SWS:NREP 1 BL:SWS:REP 1->266|YQEB_ECOLI|2e-29|31.3|262/100| RP:SCP:NREP 1 RP:SCP:REP 188->237|1e4fT1|4e-04|28.0|50/193|c.55.1.1| OP:NHOMO 91 OP:NHOMOORG 83 OP:PATTERN ------------------------1------------------------------------------- ------------------------------------------------------------------------------1------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------11--1111111111-1------1--11--11-1--12--111-------------------22-22---12112-------------11---------------------21--------------------------1----------------------------------------------------------------1-----------------------------------------------1-----------11-1---------------------------------------1-----------------1---------------1------------1--1111111111-111111111111111111--------------------------1-----1-----------------------------------------------------------------------------------------1---------------------------1------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8,278-278,284-285| PSIPRED ccccccccccEEEEEEccccHHHHHHHHEEccccEEEEEccccccEEEEEHHHHHHHHcccEEEEEEEEEEEccHHHHHHHHcccccEEccccccHHHcccccccEEEEEEHHHccccccccccccEEEEEccccccccccEEEEEccccccEEEEEEcccccccccccccccccEEEEEEEccccEEEcHHHHccEEcccEEEEEEcccEEEEccccEEEEEEcccccccccEEEEEEcccccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccc //