[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38311.1
DDBJ      :             nitrogenase iron protein subunit NifH
Swiss-Prot:NIFH_RHOPS   RecName: Full=Nitrogenase iron protein;         EC=1.18.6.1;AltName: Full=Nitrogenase component II;AltName: Full=Nitrogenase Fe protein;AltName: Full=Nitrogenase reductase;

Homologs  Archaea  22/68 : Bacteria  167/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:299 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->281 1nipA PDBj e-110 69.1 %
:RPS:PDB   6->275 2afiN PDBj 9e-45 70.3 %
:RPS:SCOP  4->274 1cp2A  c.37.1.10 * 3e-61 62.7 %
:HMM:SCOP  5->291 1fp6A_ c.37.1.10 * 8.7e-60 32.5 %
:RPS:PFM   4->42 PF02374 * ArsA_ATPase 7e-07 51.3 %
:RPS:PFM   39->153 PF00142 * Fer4_NifH 2e-58 89.6 %
:HMM:PFM   5->277 PF00142 * Fer4_NifH 1e-135 69.5 272/273  
:BLT:SWISS 1->281 NIFH_RHOPS e-150 100.0 %
:PROS 126->139|PS00692|NIFH_FRXC_2
:PROS 89->101|PS00746|NIFH_FRXC_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38311.1 GT:GENE ABE38311.1 GT:PRODUCT nitrogenase iron protein subunit NifH GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 1224040..1224939 GB:FROM 1224040 GB:TO 1224939 GB:DIRECTION + GB:PRODUCT nitrogenase iron protein subunit NifH GB:PROTEIN_ID ABE38311.1 GB:DB_XREF GI:91682009 InterPro:IPR000392 InterPro:IPR005977 LENGTH 299 SQ:AASEQ MAALRQIAFYGKGGIGKSTTSQNTLAALVELGQKILIVGCDPKADSTRLILNTKMQDTVLSLAAEAGSVEDLELEDVMKIGYKGIKCTEAGGPEPGVGCAGRGVITAINFLEENGAYEDVDYVSYDVLGDVVCGGFAMPIRENKAQEIYIVMSGEMMALYAANNIAKGILKYASSGGVRLGGLICNERQTDRELDLAEALAARLNSKLIHFVPRANIVQHAELRRQTVIEYAPDSQQAQEYRQLANKIHANSGNGTIPTPITMEELEGMLLDFGIMKTDEQALAELAEKEAAKAAAATA GT:EXON 1|1-299:0| SW:ID NIFH_RHOPS SW:DE RecName: Full=Nitrogenase iron protein; EC=1.18.6.1;AltName: Full=Nitrogenase component II;AltName: Full=Nitrogenase Fe protein;AltName: Full=Nitrogenase reductase; SW:GN Name=nifH; OrderedLocusNames=RPD_1073; SW:KW 4Fe-4S; ADP-ribosylation; ATP-binding; Complete proteome; Iron;Iron-sulfur; Metal-binding; Nitrogen fixation; Nucleotide-binding;Oxidoreductase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->281|NIFH_RHOPS|e-150|100.0|281/299| GO:SWS:NREP 8 GO:SWS GO:0051539|"GO:4 iron, 4 sulfur cluster binding"|4Fe-4S| GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0051536|"GO:iron-sulfur cluster binding"|Iron-sulfur| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0009399|"GO:nitrogen fixation"|Nitrogen fixation| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0016491|"GO:oxidoreductase activity"|Oxidoreductase| GO:SWS GO:0055114|"GO:oxidation reduction"|Oxidoreductase| PROS 126->139|PS00692|NIFH_FRXC_2|PDOC00580| PROS 89->101|PS00746|NIFH_FRXC_1|PDOC00580| SEG 191->204|dreldlaealaarl| SEG 282->297|alaelaekeaakaaaa| BL:PDB:NREP 1 BL:PDB:REP 3->281|1nipA|e-110|69.1|278/283| RP:PDB:NREP 1 RP:PDB:REP 6->275|2afiN|9e-45|70.3|269/270| RP:PFM:NREP 2 RP:PFM:REP 4->42|PF02374|7e-07|51.3|39/248|ArsA_ATPase| RP:PFM:REP 39->153|PF00142|2e-58|89.6|115/115|Fer4_NifH| HM:PFM:NREP 1 HM:PFM:REP 5->277|PF00142|1e-135|69.5|272/273|Fer4_NifH| GO:PFM:NREP 5 GO:PFM GO:0005524|"GO:ATP binding"|PF02374|IPR003348| GO:PFM GO:0006875|"GO:cellular metal ion homeostasis"|PF02374|IPR003348| GO:PFM GO:0005524|"GO:ATP binding"|PF00142|IPR000392| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00142|IPR000392| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00142|IPR000392| RP:SCP:NREP 1 RP:SCP:REP 4->274|1cp2A|3e-61|62.7|268/269|c.37.1.10| HM:SCP:REP 5->291|1fp6A_|8.7e-60|32.5|286/0|c.37.1.10|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 357 OP:NHOMOORG 191 OP:PATTERN --------------------------------1121132222233212116621-------------- -----------------------------------------111------------------------------------------------1--------------------------------3333333334322233--1--1222221221111111111116342111111111111---------------------------------------------------------------------------------------------------------------------------------------------11121111111-1-1-55------1-----316421-1-------1-1--1----------13144---84335------------22222122-1------3321121122---22-34342-----------11--135----------------------------------1-------------------2-------11---------1-----1------1-----------------11-22---1--11111-121211211--11---1---------------------1---11--1--------------------------------3---------2-----------------------------------1-1-------------------------------------------------------1-----------------------------3--------------1-------------------------------------------1-----------------------------------------------------1-- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------1------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 281 STR:RPRED 94.0 SQ:SECSTR ccccEcEEEEEcTTccHHHHHHHHHHHHHHHTccEEEEEccTTccccHHHHTccccccHHHHHHHHccTTcccHHHHcEEcGGGcEEEEcccccTTcccHHHHHHHHHHHHHHTTccccccEEEEEEEcccccTTTTHHHHTTTccEEEEEEcccHHHHHHHHHHHHHHHHTTTTcccEEEEEEEEccccTTHHHHHHHHHHHHTccEEEEEcccHHHHHHHTTTccHHHHcTTcHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHTccccccG################## DISOP:02AL 1-2,295-300| PSIPRED ccccEEEEEEccccccHHHHHHHHHHHHHHcccEEEEEccccccccccHHccccccccHHHHHHHccccccccHHHEEEEccccEEEEEccccccccccccHHHHHHHHHHHHccccccccEEEEEcccccEEccHHHHHHHHcccEEEEEccccHHHHHHHHHHHHHHHHHHHHccccEEEEEEccccccccHHHHHHHHHHHcccEEEEEcccHHHHHHHHccccEEEEccccHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccc //