[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38315.1
DDBJ      :             nitrogenase molybdenum-iron cofactor biosynthesis protein NifN
Swiss-Prot:             

Homologs  Archaea  12/68 : Bacteria  117/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.92.2
:458 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->433 1mioB PDBj 6e-62 33.2 %
:RPS:PDB   201->288 2dpnA PDBj 4e-09 24.1 %
:RPS:SCOP  2->428 1fp4A  c.92.2.3 * 2e-61 15.9 %
:HMM:SCOP  7->443 1qguB_ c.92.2.3 * 2.3e-138 37.9 %
:RPS:PFM   21->426 PF00148 * Oxidored_nitro 3e-49 34.2 %
:HMM:PFM   19->427 PF00148 * Oxidored_nitro 1.3e-114 37.2 384/398  
:BLT:SWISS 1->443 NIFN_BRAJA e-163 62.3 %
:PROS 37->44|PS00699|NITROGENASE_1_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38315.1 GT:GENE ABE38315.1 GT:PRODUCT nitrogenase molybdenum-iron cofactor biosynthesis protein NifN GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 1229641..1231017 GB:FROM 1229641 GB:TO 1231017 GB:DIRECTION + GB:PRODUCT nitrogenase molybdenum-iron cofactor biosynthesis protein NifN GB:PROTEIN_ID ABE38315.1 GB:DB_XREF GI:91682013 InterPro:IPR000318 InterPro:IPR000510 InterPro:IPR005975 LENGTH 458 SQ:AASEQ MAKVVTSTKSCTVNPLRMSQPLGAALAFMGLRNSMPLLHGSQGCTSFGLVLFVRHFREQIPLQTTAMSEVATVLGGFENVEQAIVNIVGRTKPDVIGICTTGVTEIKGDDLDGFIKLVRGKHPELANVALVPVSTPDFKGAFEDGFATTVAKIVETLVEAPAAGVGRDPAKLNVLAGSHLTPGDIDELRDIIEAFGLVPTFLPDISGSLDGHLPEDFTPTTHGGVSVAEVAAMGRAAHTLALGEQMRKAAAALEAKVGVPFTLLQRLTGLAPSDELMATLARISGRPVPPKYRRQRSQLVDAMLDGHFYFGGKRIAIGAEPDMLLNIGGWLADMGCTIAAAVTTTHSPALAQAPSDDVLIGDLEDLEQRAEDCDLLVTHSHGRQAAERLGVPLFRVGLPMFDRLGAAHQVAVGYRGTRDLIFAIGNLFISNIKEPDVDTWRSTAAGGPDQVDASVTTH GT:EXON 1|1-458:0| BL:SWS:NREP 1 BL:SWS:REP 1->443|NIFN_BRAJA|e-163|62.3|443/469| PROS 37->44|PS00699|NITROGENASE_1_1|PDOC00085| BL:PDB:NREP 1 BL:PDB:REP 3->433|1mioB|6e-62|33.2|422/457| RP:PDB:NREP 1 RP:PDB:REP 201->288|2dpnA|4e-09|24.1|87/492| RP:PFM:NREP 1 RP:PFM:REP 21->426|PF00148|3e-49|34.2|374/389|Oxidored_nitro| HM:PFM:NREP 1 HM:PFM:REP 19->427|PF00148|1.3e-114|37.2|384/398|Oxidored_nitro| GO:PFM:NREP 2 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00148|IPR000510| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00148|IPR000510| RP:SCP:NREP 1 RP:SCP:REP 2->428|1fp4A|2e-61|15.9|397/467|c.92.2.3| HM:SCP:REP 7->443|1qguB_|2.3e-138|37.9|435/519|c.92.2.3|1/1|"Helical backbone" metal receptor| OP:NHOMO 291 OP:NHOMOORG 129 OP:PATTERN ----------------------------------3--22222222-----652--------------- -----------------------------------------222------------------------------------------------2--------------------------------22222222232---11--2---22222-22------------5232---------------------------------------------------------------------------------------------------------------------------------------------------------2-22----------1-55------------212222---------1----2----------32222---63223--------------2--2---2------3332222222------2223------------22--224----------------------------------2-------------------2-------22---------2-----2------2-----------------22-22---2--22222-222222222--22---2---------------------2---22--2--------------------------------2---------3-----------------------------------2-2-------------------------------------------------------2-----------------------------5--------------2-------------------------------------------2-----------------------------------------------------2-- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 436 STR:RPRED 95.2 SQ:SECSTR ##cccccccccccccccccTHHHHHHHHTTcTTEEEEEEccHHHHHHHHHHHHHHHccccccEEccccTTHHHHccHHHHHHHHHHHHHHTcccEEEEEEcHHHHHHTccHHHHHHHHHTcccTccTcEEEEEcccTTcccHHHHHHHHHHHHEEEEEEEEEcccHHHHHHHHHTcccccccccHHHHHTTccccTTcEEEEccTTcccTTTccTTcccEEEcccTTccHHHHHHHHHHHHHHHHHHHHHHHHHTTTccccccEEEEcGGGGcHHHHHHHHHHHTccEcHHHHHEEcccccHHHHHHHHHHHcEHTTcccccHHHHHHHHHHTTTcEEEEEEEccccccHHHHHHHHHHHccHHHHHHHHccccEEEEcGGGHHHHHHHTccEEEccccccccccGGGcccccTHHHHHHHHHHHHHHHHHHHH#HHHT################### DISOP:02AL 1-10,446-459| PSIPRED ccEEEcccccccccHHHHHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHHHcccccccccEEccccHHHHHHccHHHHHHHHHHHHHHccccEEEEEccccHHHHcccHHHHHHHHHHHccccccccEEEEEcccccccHHHHHHHHHHHHHHHHccccccccccccccEEEEccccccHHHHHHHHHHHHHccccEEEEccccccccccccccccEEccccccHHHHHHcccccEEEEEcHHHHHHHHHHHHHHcccEEEccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccEEEEEEccHHHHHHHHHHHHHcccEEEEEEEccccHHHHHcccccEEEccHHHHHHHHccccEEEEcccHHHHHHHHcccEEEEcHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHcccccHHHccccccccccccccccc //