[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38337.1
DDBJ      :             putative acyl carrier protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:71 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   2->46 PF00550 * PP-binding 1.5e-08 37.8 45/67  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38337.1 GT:GENE ABE38337.1 GT:PRODUCT putative acyl carrier protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(1248203..1248418) GB:FROM 1248203 GB:TO 1248418 GB:DIRECTION - GB:PRODUCT putative acyl carrier protein GB:PROTEIN_ID ABE38337.1 GB:DB_XREF GI:91682035 LENGTH 71 SQ:AASEQ MQEIAAEQNRKLPALTDDLVLHQSGFDSLCFAILVARLEDKLGVDPFTAADDAIFPVTLGDFIKAYENVPA GT:EXON 1|1-71:0| HM:PFM:NREP 1 HM:PFM:REP 2->46|PF00550|1.5e-08|37.8|45/67|PP-binding| OP:NHOMO 12 OP:NHOMOORG 11 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------21------11-------------111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8,71-72| PSIPRED cHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHcccc //