[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38346.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  5/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:119 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   45->113 PF04892 * VanZ 6e-07 20.3 69/133  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38346.1 GT:GENE ABE38346.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 1259464..1259823 GB:FROM 1259464 GB:TO 1259823 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE38346.1 GB:DB_XREF GI:91682044 LENGTH 119 SQ:AASEQ MPELSTKLQTMLRVAAWLCLAAVAFATLSPLGIRPTTGLPPSIERFAAFALVGAMFAAAYPRYILFAAAIVLGAAALFEFLQVLAPSRHGRLFDAGVKFSGGTVGLIAGWLSVRWIARR GT:EXON 1|1-119:0| TM:NTM 4 TM:REGION 8->30| TM:REGION 39->61| TM:REGION 65->87| TM:REGION 96->117| SEG 14->26|vaawlclaavafa| SEG 46->59|faafalvgamfaaa| SEG 64->78|ilfaaaivlgaaalf| HM:PFM:NREP 1 HM:PFM:REP 45->113|PF04892|6e-07|20.3|69/133|VanZ| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-11-----------------------------1----1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //