[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38364.1
DDBJ      :             Enoyl-[acyl-carrier-protein] reductase (NADH)
Swiss-Prot:             

Homologs  Archaea  12/68 : Bacteria  747/915 : Eukaryota  122/199 : Viruses  0/175   --->[See Alignment]
c.2.1
:258 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->258 3k2eA PDBj 5e-66 45.3 %
:RPS:PDB   1->255 1dohB PDBj 1e-25 21.1 %
:RPS:SCOP  8->258 1c14A  c.2.1.2 * 1e-29 43.0 %
:HMM:SCOP  9->257 1uh5A_ c.2.1.2 * 4.5e-60 33.2 %
:HMM:PFM   23->180 PF00106 * adh_short 1.3e-10 21.1 152/167  
:BLT:SWISS 8->258 FABI_HELPJ 2e-60 43.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38364.1 GT:GENE ABE38364.1 GT:PRODUCT Enoyl-[acyl-carrier-protein] reductase (NADH) GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 1281378..1282154 GB:FROM 1281378 GB:TO 1282154 GB:DIRECTION + GB:PRODUCT Enoyl-[acyl-carrier-protein] reductase (NADH) GB:PROTEIN_ID ABE38364.1 GB:DB_XREF GI:91682062 InterPro:IPR002347 LENGTH 258 SQ:AASEQ MTLHGKTLHGKKGLVVGIANADSIAFGCARAFRDAGAELAVTYLNDKAKPYVGPLAEQLQSPIVVPCDVREPGQLEAVFAQIGERWGRLDFLLHSIAFAPKDDLQGRVVDCSQAGFAMAMDVSCHSFIRMARLAEPLMPDGGCLLTVSFYGSDKVVEDYNLMGPVKAALESSVRYMAAELAPKRIRVHALSPGPLKTRAASGIARFDELLERTRARAPAHNLVSIEDVGNVATFLVGDGASALTGNIEYIDAGYHVVG GT:EXON 1|1-258:0| BL:SWS:NREP 1 BL:SWS:REP 8->258|FABI_HELPJ|2e-60|43.8|251/275| BL:PDB:NREP 1 BL:PDB:REP 5->258|3k2eA|5e-66|45.3|254/260| RP:PDB:NREP 1 RP:PDB:REP 1->255|1dohB|1e-25|21.1|251/271| HM:PFM:NREP 1 HM:PFM:REP 23->180|PF00106|1.3e-10|21.1|152/167|adh_short| RP:SCP:NREP 1 RP:SCP:REP 8->258|1c14A|1e-29|43.0|251/256|c.2.1.2| HM:SCP:REP 9->257|1uh5A_|4.5e-60|33.2|247/0|c.2.1.2|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 2352 OP:NHOMOORG 881 OP:PATTERN 11------------1----1-------1-1-2---------------1--------------2-1-11 576141--1111--35255-56112854555169B95286421A1222122-321-11--425153785521--------2-5112221222-2--1--123144B482311111111111111111123111331211232223112531121111111112121544A11111111111113332222-635222221211122222354434222436243133333321322111111122211311213-111112-1-1111--1111--1111-11------111111111111111111111111-11---111-211-1-----------1-1-1111-1-122-----------21-------3-6844522222579862245556444554554556-476447568B7287726658AB77752445475554535111111114664235311111111111111111111211111111154522476559AA7B726666885A666624A695EB522433327333731871131112411111111213332-31221111111121222212121233454--22222222221222222222112223311-1221-4--1---1232----2-13---1-11211111111221212-3333333333-33333333433333333324645211232222222222222223333322311-111111-1111111------23231222-11111111111111123353122325-665524553333279771111111111----111111--113222322-------111-332211--------------------------------------1-----1-132 11---12-1-----223112343434411122211-1222222---12343566123--423-----1--1--------1-------1-212334122221-1211-311G24443------1----------1------1114--1-------1---387518467123---122331O1114334382432242321 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 258 STR:RPRED 100.0 SQ:SECSTR ccGGGGccTTcEEEETTTTcHHHHHHHHHHHHTTcEEEEEEcccHHHHHHHHHHHHHTTccEEEEEccTTcHHHHHHHHHHHHHHHccccEEEEcccccccccccccGGGccHHHHHHHHHHHTHHHHHHHHHHHHHcTTcEEEEEccGGGTcccccccHHHHHHHHHHHHHHHHHHHHHGGGTcEEEEEEEcccccHHHHHHGGGGcTTHHHHHccTTcccccHHHHHHHHHHHHcGGGTTccccEEEEcccccGcc DISOP:02AL 1-5| PSIPRED cccccccccccEEEEEccccccHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHHHccccEEEEcccccccccccccHHHccHHHHHHHHHHHcHHHHHHHHHHHHHHHHccEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEcccccccHHHHHccccHHHHHHHHHcccccccccHHHHHHHHHHHHcHHHccccccEEEEccccEEEc //