Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38368.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:105 amino acids

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38368.1 GT:GENE ABE38368.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 1285923..1286240 GB:FROM 1285923 GB:TO 1286240 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABE38368.1 GB:DB_XREF GI:91682066 LENGTH 105 SQ:AASEQ MRAVEFLVPVLAGIVAASSAMAADYPPTSYRPVYRSAPIAYPAPRLVGIPQAPPVIWVEAPPQYVQHLVPTGGCGGCGPQYRAVGEWRRTPPPSFWDSIYRDYGY GT:EXON 1|1-105:0| TM:NTM 1 TM:REGION 1->21| SEG 16->23|aassamaa| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1| PSIPRED ccHHHHHHHHHHHHHHHHHHHcccccccccccHHHccccccccccEEcccccccEEEEEccHHHHHHHccccccccccccHHHHHHHccccccHHHHHHHHHHcc //