[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38395.1
DDBJ      :             Sulfate ABC transporter, permease protein CysT
Swiss-Prot:             

Homologs  Archaea  52/68 : Bacteria  734/915 : Eukaryota  9/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:279 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   84->264 3d31C PDBj 3e-26 34.1 %
:RPS:PDB   165->204 3dhwA PDBj 1e-11 27.5 %
:RPS:SCOP  84->270 2r6gG1  f.58.1.1 * 3e-19 27.1 %
:RPS:PFM   94->266 PF00528 * BPD_transp_1 8e-13 34.1 %
:HMM:PFM   82->272 PF00528 * BPD_transp_1 6.8e-29 24.9 173/185  
:BLT:SWISS 20->246 CYST_NEPOL 6e-60 48.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38395.1 GT:GENE ABE38395.1 GT:PRODUCT Sulfate ABC transporter, permease protein CysT GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 1316823..1317662 GB:FROM 1316823 GB:TO 1317662 GB:DIRECTION + GB:PRODUCT Sulfate ABC transporter, permease protein CysT GB:PROTEIN_ID ABE38395.1 GB:DB_XREF GI:91682093 InterPro:IPR000515 InterPro:IPR005667 InterPro:IPR011865 LENGTH 279 SQ:AASEQ MDVSAVSRRSLPGFGLTMGLTIMWLSLMILIPLAGLFVKTAELSPSEFLATVTAPRTLHALKISFGLAFAAAAVNLVAGLLIVWALVRYRFPGRRIFDAIVDIPFALPTAVAGIALTALFAQKGWLGAPLAELGIKVAFTPLGIFIAMIFIGIPFVVRTVQPVLIDLDVELEEAAECLGASRWQTIRRVILPSLAPAALTGFALAFARAVGEYGSVIFIAGNLPNVSEIAPLLIVIRLAEFRYADATAIAVVMLIFSFLIIFVLNRIQHWAQTRSLAVA GT:EXON 1|1-279:0| BL:SWS:NREP 1 BL:SWS:REP 20->246|CYST_NEPOL|6e-60|48.0|227/284| TM:NTM 7 TM:REGION 20->41| TM:REGION 64->86| TM:REGION 98->120| TM:REGION 138->160| TM:REGION 189->211| TM:REGION 216->238| TM:REGION 245->267| SEG 65->81|fglafaaaavnlvagll| BL:PDB:NREP 1 BL:PDB:REP 84->264|3d31C|3e-26|34.1|176/248| RP:PDB:NREP 1 RP:PDB:REP 165->204|3dhwA|1e-11|27.5|40/203| RP:PFM:NREP 1 RP:PFM:REP 94->266|PF00528|8e-13|34.1|170/195|BPD_transp_1| HM:PFM:NREP 1 HM:PFM:REP 82->272|PF00528|6.8e-29|24.9|173/185|BPD_transp_1| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00528|IPR000515| GO:PFM GO:0006810|"GO:transport"|PF00528|IPR000515| GO:PFM GO:0016020|"GO:membrane"|PF00528|IPR000515| RP:SCP:NREP 1 RP:SCP:REP 84->270|2r6gG1|3e-19|27.1|177/284|f.58.1.1| OP:NHOMO 2895 OP:NHOMOORG 795 OP:PATTERN ----2111111111112------1234232312-321267653342751163312412312-1-1--- -21-53222222-344422-23--462222245444355513211132422122321111115133225331-11---11114-1221111-11--------1--1-11----------------2312212423233334--17316744454555-----235246661------------1111324-3234342456444445347333334463556212333333AB11111111111111122212411122--1111122221--2212221111111111322233333221111111111211-2222222211121444433432331233-4444132362462444231-2122123-121114333-----33A9A3354657699AA9A98AAD-444332432C4-8CCA658886DCF91--13D8AAA44422222222-33-2538-----------------------------1-112-39967A9AA9C53444DDFE566536DCD7475-16655344454B65C89A2333372333333223344-3624344217443153214446231334223312111111-1-111111111341111444241--1-134444111444527125112---311------75751636776666666-7656667666766556656656CD5567677777776777777666656662-5444444444442212---------4-329333545223233224333232344455767677A8A686857781--1-----12223777772226422333333332222--11332222---------1---------1--------1-------2311-1111115- -------------1------------------------------------------------------------------------------------------------------------------------------------------------2----1-----------222-----12---1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 187 STR:RPRED 67.0 SQ:SECSTR #################################################################################HHHHHTTcccTTHHHHHHHHHGGGTccHHHHHHHHHHHHcTTcTTTGGGTTTTcccTTcHHHHHHHHHHHHHHHHHHHHHHHHHHccTTTTTHHHHHTccTHHHHHHTTHHHHHHHHHHHHHHHHHHHHTccHHHHHHHccGGcTTccHHHHHHHHHHHcTTTTTHHHHHHHHHHHHHHHHHH##HTTT######### DISOP:02AL 1-10,275-280| PSIPRED cccHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //