[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38399.1
DDBJ      :             nickel-dependent hydrogenase, large subunit
Swiss-Prot:             

Homologs  Archaea  14/68 : Bacteria  251/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
e.18.1
:481 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->481 1cc1L PDBj 7e-34 28.1 %
:RPS:PDB   1->481 1e3dB PDBj 3e-61 24.6 %
:RPS:SCOP  4->481 1cc1L  e.18.1.1 * 9e-71 24.7 %
:HMM:SCOP  1->481 1frfL_ e.18.1.1 * 1e-117 38.3 %
:RPS:PFM   280->481 PF00374 * NiFeSe_Hases 3e-30 41.4 %
:HMM:PFM   39->126 PF00374 * NiFeSe_Hases 2e-16 37.5 88/507  
:HMM:PFM   147->481 PF00374 * NiFeSe_Hases 7.4e-45 33.5 319/507  
:BLT:SWISS 4->481 PHSL_DESBA 1e-33 27.8 %
:PROS 39->64|PS00507|NI_HGENASE_L_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38399.1 GT:GENE ABE38399.1 GT:PRODUCT nickel-dependent hydrogenase, large subunit GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 1320750..1322195 GB:FROM 1320750 GB:TO 1322195 GB:DIRECTION + GB:PRODUCT nickel-dependent hydrogenase, large subunit GB:PROTEIN_ID ABE38399.1 GB:DB_XREF GI:91682097 InterPro:IPR001501 LENGTH 481 SQ:AASEQ MNRRVTVGPFNRVEGDLEVRLDIDGGVVTSAEVTAPLYRGFEQILRGRPALDALTLAPRICGICSVSQSLAAAAALRAVDGFRAADNGVLAANLAHAAENAADHLTHFYLFFMPDFARDAYAARPWHPDIATRFKAVQGSAAQQMLPARARLLQIMGLLAGKWPHSLAFQPGGTTRAIDLGERVQLLSIIGDLRDVLERIVFADSLDNVLALDSAAALERWRDGRGGDFARFLALADDLALDRLGRIALPLMSYGAYHGGDAPLFAAGVFDPATAQAHPLDPNDISEDVARAWMRDTSLRPSEAETDPDADKQAGYSWCKAPRLAGRPVEVGALARQAVDGDPLIRDLLARQGPNVSVRVIARLIETARLAAAMHDWARRLDLRAPFLERAERRGEGAGIGLIEAARGSLGHWIELSDDNIRRYQIIAPTTWNFSPRDRDGVAGPLEQALAGTAVGDEGARSVAIQHIVRSFDPCMVCTAH GT:EXON 1|1-481:0| BL:SWS:NREP 1 BL:SWS:REP 4->481|PHSL_DESBA|1e-33|27.8|449/514| PROS 39->64|PS00507|NI_HGENASE_L_1|PDOC00400| SEG 71->85|aaaaalravdgfraa| SEG 90->102|laanlahaaenaa| SEG 228->244|dfarflaladdlaldrl| SEG 388->408|leraerrgegagiglieaarg| BL:PDB:NREP 1 BL:PDB:REP 4->481|1cc1L|7e-34|28.1|448/486| RP:PDB:NREP 1 RP:PDB:REP 1->481|1e3dB|3e-61|24.6|480/537| RP:PFM:NREP 1 RP:PFM:REP 280->481|PF00374|3e-30|41.4|198/243|NiFeSe_Hases| HM:PFM:NREP 2 HM:PFM:REP 39->126|PF00374|2e-16|37.5|88/507|NiFeSe_Hases| HM:PFM:REP 147->481|PF00374|7.4e-45|33.5|319/507|NiFeSe_Hases| GO:PFM:NREP 3 GO:PFM GO:0008901|"GO:ferredoxin hydrogenase activity"|PF00374|IPR001501| GO:PFM GO:0016151|"GO:nickel ion binding"|PF00374|IPR001501| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00374|IPR001501| RP:SCP:NREP 1 RP:SCP:REP 4->481|1cc1L|9e-71|24.7|449/487|e.18.1.1| HM:SCP:REP 1->481|1frfL_|1e-117|38.3|452/543|e.18.1.1|1/1|HydB/Nqo4-like| OP:NHOMO 430 OP:NHOMOORG 265 OP:PATTERN ------1----------------------------11112111---1---223-----------1--- 112---1--------1--------12------1111-111-221---------------------11------------111-3122------1-------1-----------------------11-111-111111121111-1-12-11---------------1111-----------------------------------------------------------------------------------------------------------------------------------------------------------1111111111-11---------------2344--1-1-1--------11----------21324---222-2------------------------------------22-----22222-----------1----3-1---------------------------------1--------------------1-------2---31-----12----2-2----21--------------1-24-33-422321233312-22123--2222---421--1111111111111111212232211-1-------11111-111111111111-----2-1------1-112--2222222222-2122222222222222222---1---13333333333323232-2222222--1------------------------1----111111-------------------1---------------------------1------------------------------2-----------------------------------------------------111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 481 STR:RPRED 100.0 SQ:SECSTR ccEEEEEcccccccccEEEEEEEETTEEEEEEEEEcccccHHHHHTTccGGGHHHHHHTTccTTTTHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHTTGGGTccTTGGccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHTcccGGGTTcTTTTccTTccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHETTEEccGGGGcHHHHHHHHHHHHHHHHHHHHTHHHHHHHHHHEEEEEcccGGGccEEEEEcTTcGGGcccccGGGEEEEcTTcTcccccccGGGccccccTTcccccccccEEEETTccccccHHHHHHHHHHHHHHTccGGGGccHHHHHHHHHHHHHHHHHHHHHHHHHHHTcccccccccccccEEEEEEEEETTEEEEEEEEEETTEEEEEEEEcHHHHHTccccTTccccHHHHHHTTcccccTTTccHHHHHHHHHTcccHHHHHc DISOP:02AL 1-1| PSIPRED cccEEEEcccccEEccEEEEEEEEccEEEEEEEEEEEcHHHHHHHccccHHHHHHHHcccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHccHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHcccccccccEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccccEEccccccccccccccEEEccccccEEEccHHHccHHHHHHHHccccccccccccccccccccccEEEcccccccEEEEEcHHHHHHHcccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHccccccEEEEEEccccEEEEEEEcccEEEEEEEEcccccccccccccccccHHHHHHcccccccccccHHHHHHHHHHHccccccccc //