[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38400.1
DDBJ      :             hydrogenase (NiFe) small subunit (hydA)
Swiss-Prot:             

Homologs  Archaea  9/68 : Bacteria  245/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.81.1e.19.1
:377 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   50->310 1yq9A PDBj 4e-62 45.3 %
:RPS:PDB   52->311 1e3dA PDBj 6e-66 43.6 %
:RPS:SCOP  17->66 1q16A2  c.81.1.1 * 5e-04 8.0 %
:RPS:SCOP  52->311 1cc1S  e.19.1.1 * 2e-86 36.6 %
:HMM:SCOP  47->313 1h2rS_ e.19.1.1 * 1.6e-87 40.0 %
:RPS:PFM   63->207 PF01058 * Oxidored_q6 5e-10 33.3 %
:HMM:PFM   63->208 PF01058 * Oxidored_q6 2.9e-31 32.6 129/131  
:BLT:SWISS 1->328 MBHS_BRAJA e-175 86.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38400.1 GT:GENE ABE38400.1 GT:PRODUCT hydrogenase (NiFe) small subunit (hydA) GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 1322432..1323565 GB:FROM 1322432 GB:TO 1323565 GB:DIRECTION + GB:PRODUCT hydrogenase (NiFe) small subunit (hydA) GB:PROTEIN_ID ABE38400.1 GB:DB_XREF GI:91682098 InterPro:IPR001821 InterPro:IPR006137 InterPro:IPR006311 LENGTH 377 SQ:AASEQ MGAETETFYEVIRRQGITRRSFVKFCSLTATSLGLGPIGASQIAQALETKPRIPVIWMHGLECTCCSESFIRSAHPLVKDAVLSMISLDYDDTIMAAAGHQAEAILEETRTKYKGQYILAVEGNPPLNEDGMYCIDGGRPFVEKLKEMADDSMAVIAWGACASWGCVQAAKPNPTQAVPIDKVIKNKPIIKVPGCPPIAEVMTGVVTYVTTFGKLPELDRQGRPKMFYSQRIHDKCYRRSHFDAGQFVEEWDDDAARKGYCLYKMGCKGPTTYNACSTVRWNGGVSFPIQSGHGCIGCSEDGFWDQGPFYERLTTINQFGIEANADKIGATAAGVVGAAIAAHAAVTTVRNLSRRKEVPAGGDGNGKSSGSSNGTSA GT:EXON 1|1-377:0| BL:SWS:NREP 1 BL:SWS:REP 1->328|MBHS_BRAJA|e-175|86.6|328/363| SEG 178->193|vpidkviknkpiikvp| SEG 329->349|gataagvvgaaiaahaavttv| SEG 361->376|ggdgngkssgssngts| BL:PDB:NREP 1 BL:PDB:REP 50->310|1yq9A|4e-62|45.3|256/261| RP:PDB:NREP 1 RP:PDB:REP 52->311|1e3dA|6e-66|43.6|257/262| RP:PFM:NREP 1 RP:PFM:REP 63->207|PF01058|5e-10|33.3|126/128|Oxidored_q6| HM:PFM:NREP 1 HM:PFM:REP 63->208|PF01058|2.9e-31|32.6|129/131|Oxidored_q6| GO:PFM:NREP 4 GO:PFM GO:0008137|"GO:NADH dehydrogenase (ubiquinone) activity"|PF01058|IPR006137| GO:PFM GO:0048038|"GO:quinone binding"|PF01058|IPR006137| GO:PFM GO:0051539|"GO:4 iron, 4 sulfur cluster binding"|PF01058|IPR006137| GO:PFM GO:0055114|"GO:oxidation reduction"|PF01058|IPR006137| RP:SCP:NREP 2 RP:SCP:REP 17->66|1q16A2|5e-04|8.0|50/1074|c.81.1.1| RP:SCP:REP 52->311|1cc1S|2e-86|36.6|254/275|e.19.1.1| HM:SCP:REP 47->313|1h2rS_|1.6e-87|40.0|265/267|e.19.1.1|1/1|HydA/Nqo6-like| OP:NHOMO 384 OP:NHOMOORG 254 OP:PATTERN -----1----------1--11-11--------------------------223--------------- 112---1--------1---------1------1111-111-112---------------------111-----------111-3322------1-------1-----------------------1--111-1111---21111-1-11-11---------------1111-----------------------------------------------------------------------------------------------------------------------------------------------------------1111111111-11---------------2244--1-1-1---------1----------11313---111-1------------------------------------11-----11111-----------1----2-1---------------------------------1--------------------1-------1---11------2----2-1----11----------------13-12-212321233312-22123--1121---131111222222121111111113232211-1-------11111-111111111111-----1-1------1-112--2222222222-2222222222222222122---1---13332333333323222-2222222--1------------------------1----111111-------------------1---------------------------1------------------------------1-----------------------------------------------------1-1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 263 STR:RPRED 69.8 SQ:SECSTR #################################################ccccEEEEEEcccccHHHHHHHTccTTcHHHHHHTTcEEEEcTTTccccHHHHHHHHHHHHTccccccEEEEEccEEcTGGGTTcEETTEEHHHHHHHHGGGccEEEEEcHHHHHcGGGGcTTcTTcEEcHHHHHGGGTcccEEcccccHHHHHHHHHHHHTTTccccccTTcccHHHHcccHHHHcTTHHHHHTTccccccccHHHHTTcccGGGTccGGGccccHHHHccTTTTccTGGGTcccccTTcTTHHHHccTTcc################################################################# DISOP:02AL 1-4,353-378| PSIPRED cccccccHHHHHHHccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccEEEEEccccccHHHHHHHcccccHHHHHHccccEEEcccccHHHHHHHHHHHHHHHHcccccEEEEEEccccccccccEEEEccccHHHHHHHHHHcccEEEEEcccccccccccccccccccccHHHHHccccEEEcccccccHHHHHHHHHHHHHccccccHHHccccccccccccccccccccccccccccccccccccccccccHHcccccccEEccccccccccccccccccccccccccccccccccccHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccc //