[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38404.1
DDBJ      :             HupE/UreJ protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  87/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:194 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   10->152 PF04955 * HupE_UreJ 4e-16 46.0 %
:HMM:PFM   14->190 PF04955 * HupE_UreJ 2.7e-57 59.4 175/180  
:BLT:SWISS 14->153 HUPE_RHILV 6e-32 46.7 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38404.1 GT:GENE ABE38404.1 GT:PRODUCT HupE/UreJ protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 1326987..1327571 GB:FROM 1326987 GB:TO 1327571 GB:DIRECTION + GB:PRODUCT HupE/UreJ protein GB:PROTEIN_ID ABE38404.1 GB:DB_XREF GI:91682102 InterPro:IPR007038 LENGTH 194 SQ:AASEQ MTRLIRAGALASLALCLPGLAEAHTGVHPLVADGAAAGFAHPLLGADHLLAMVAVGLWAASLGGRARWLVPASFIALMTIGAVCGATGVALPAVEPMIGLSVIALGALVAASVRVPAIAAAAVVALFGLFHGFAHGAEMPAMASPLAYGLGFIAATALLHGAGLAFGGLLSRAPALKLAGGAIAAAGVALALPL GT:EXON 1|1-194:0| BL:SWS:NREP 1 BL:SWS:REP 14->153|HUPE_RHILV|6e-32|46.7|137/100| TM:NTM 6 TM:REGION 6->28| TM:REGION 37->59| TM:REGION 71->93| TM:REGION 106->128| TM:REGION 144->166| TM:REGION 173->194| SEG 109->125|vaasvrvpaiaaaavva| SEG 154->170|aatallhgaglafggll| SEG 173->193|apalklaggaiaaagvalalp| RP:PFM:NREP 1 RP:PFM:REP 10->152|PF04955|4e-16|46.0|139/183|HupE_UreJ| HM:PFM:NREP 1 HM:PFM:REP 14->190|PF04955|2.7e-57|59.4|175/180|HupE_UreJ| OP:NHOMO 100 OP:NHOMOORG 87 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------1--------------------------------------------------------------2---11---------1-21-----1--------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-12---1-1------------2------1-111---1131121121-12---1-21-11-------------------------------------------------------111-------------------------1-12-1111-1----1-11--1--1-11-----------------------------------------------------------------------------1----1-21111---111111-111----1--1----------1----------------------------------------------------------------------------------------1--1--12-----------------------1-1------1-11----1111------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,4-4| PSIPRED cHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHcHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHccHHHHHHHHHHHccc //