[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38409.1
DDBJ      :             putative hydrogenase expression/formation protein HupJ
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  25/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:176 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   31->153 PF11939 * DUF3457 9e-19 44.7 %
:HMM:PFM   13->171 PF11939 * DUF3457 2.9e-53 51.3 152/156  
:BLT:SWISS 31->175 HUPJ_BRAJA 1e-23 57.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38409.1 GT:GENE ABE38409.1 GT:PRODUCT putative hydrogenase expression/formation protein HupJ GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 1329584..1330114 GB:FROM 1329584 GB:TO 1330114 GB:DIRECTION + GB:PRODUCT putative hydrogenase expression/formation protein HupJ GB:PROTEIN_ID ABE38409.1 GB:DB_XREF GI:91682107 LENGTH 176 SQ:AASEQ MTAEPGPDRDANARAAGEALAARYREAEPAMRDLPVYNPALRVVAIGFRATDDDAIGVVVTPWFMNLVRIPAPGSAADAQHGAVVSRALPAGVLDFTIGLLDGFGPVESCSLFSPMFGFADQQAAETTARAALAAVLDPNFTADPKPEPAARQPGATAVALDRRRFLRGALSESRP GT:EXON 1|1-176:0| BL:SWS:NREP 1 BL:SWS:REP 31->175|HUPJ_BRAJA|1e-23|57.2|138/169| SEG 11->30|anaraagealaaryreaepa| SEG 120->138|adqqaaettaraalaavld| RP:PFM:NREP 1 RP:PFM:REP 31->153|PF11939|9e-19|44.7|123/153|DUF3457| HM:PFM:NREP 1 HM:PFM:REP 13->171|PF11939|2.9e-53|51.3|152/156|DUF3457| OP:NHOMO 27 OP:NHOMOORG 26 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-111---111-1------------------------------------11-----11111-------------------------------------------------------------------------1-------1---11------1----1-------------------------2---------------------------------------------------------------------------------------------1------------------------------------------------1-------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-9,144-158,174-177| PSIPRED ccccccccccccHHHHHHHHHHHHHHccHHHcccccccccccEEEEccEEEccEEEEEEccHHHHHEEEEcccccccccccccEEEEEccccEEEEEEcccccccHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcHHHHHcccccccccccccccccHHHHHHHHHHHHHccc //