[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38426.1
DDBJ      :             modD protein
Swiss-Prot:             

Homologs  Archaea  46/68 : Bacteria  186/915 : Eukaryota  6/199 : Viruses  0/175   --->[See Alignment]
c.1.17d.41.2
:291 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   63->235 1qpnA PDBj 8e-15 31.2 %
:RPS:PDB   5->205 2e5bA PDBj 1e-19 8.8 %
:RPS:SCOP  6->113 1qapA2  d.41.2.1 * 6e-10 13.9 %
:RPS:SCOP  114->286 1o4uA1  c.1.17.1 * 2e-11 20.6 %
:HMM:SCOP  8->113 1qpoA2 d.41.2.1 * 3e-23 34.0 %
:HMM:SCOP  114->285 1qapA1 c.1.17.1 * 1.3e-41 35.5 %
:RPS:PFM   114->236 PF01729 * QRPTase_C 5e-12 38.5 %
:HMM:PFM   114->282 PF01729 * QRPTase_C 6.9e-32 29.5 166/169  
:HMM:PFM   25->111 PF02749 * QRPTase_N 8.3e-19 31.0 87/88  
:BLT:SWISS 16->285 MODD_ECOL6 2e-31 29.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38426.1 GT:GENE ABE38426.1 GT:PRODUCT modD protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 1345275..1346150 GB:FROM 1345275 GB:TO 1346150 GB:DIRECTION + GB:PRODUCT modD protein GB:PROTEIN_ID ABE38426.1 GB:DB_XREF GI:91682124 InterPro:IPR002638 InterPro:IPR006242 LENGTH 291 SQ:AASEQ MPILKDVRMPAATTTELERLLDDDVPHGDLTTEALGIGGQAGVMEFTARDPMVLALVDDAAAILGLCGCEVERMAMSGSRLAPGAPILTARGGAAGLLRGWKVAQTLVEIWSGVATATREIVDAARAVSPHIAVACTRKNTPGTKRFAVAAVKSGGAVMHRLGLSETILVFGEHRGFLDEPLAATVERLRRAAPEKKLVTEVSSIEAALAAAEAGFDVVQLEKFAPADVATLAQRLATGPHRPVIAAAGGVNASNAAAYAQAGAQVLVTSSPYMAKPRDVQVKIRREQQTN GT:EXON 1|1-291:0| BL:SWS:NREP 1 BL:SWS:REP 16->285|MODD_ECOL6|2e-31|29.6|270/284| SEG 53->62|vlalvddaaa| SEG 90->100|arggaagllrg| SEG 206->214|eaalaaaea| SEG 246->266|aaaggvnasnaaayaqagaqv| BL:PDB:NREP 1 BL:PDB:REP 63->235|1qpnA|8e-15|31.2|170/284| RP:PDB:NREP 1 RP:PDB:REP 5->205|2e5bA|1e-19|8.8|193/466| RP:PFM:NREP 1 RP:PFM:REP 114->236|PF01729|5e-12|38.5|117/169|QRPTase_C| HM:PFM:NREP 2 HM:PFM:REP 114->282|PF01729|6.9e-32|29.5|166/169|QRPTase_C| HM:PFM:REP 25->111|PF02749|8.3e-19|31.0|87/88|QRPTase_N| GO:PFM:NREP 2 GO:PFM GO:0004514|"GO:nicotinate-nucleotide diphosphorylase (carboxylating) activity"|PF01729|IPR002638| GO:PFM GO:0009435|"GO:NAD biosynthetic process"|PF01729|IPR002638| RP:SCP:NREP 2 RP:SCP:REP 6->113|1qapA2|6e-10|13.9|108/122|d.41.2.1| RP:SCP:REP 114->286|1o4uA1|2e-11|20.6|160/162|c.1.17.1| HM:SCP:REP 8->113|1qpoA2|3e-23|34.0|106/115|d.41.2.1|1/1|Nicotinate/Quinolinate PRTase N-terminal domain-like| HM:SCP:REP 114->285|1qapA1|1.3e-41|35.5|166/0|c.1.17.1|1/1|Nicotinate/Quinolinate PRTase C-terminal domain-like| OP:NHOMO 260 OP:NHOMOORG 238 OP:PATTERN -----1-111111111-11--111111--1---11-1-11111111-21222211111111-----11 -11-1--------1---11-1-111-111111-111-1--1-----11-------1------1-1---11-----11---11-11--1-------------------------------------22111131111---11-------1----1---11--1---------111---11--1--1-----1-------------------111-------1--11---------------------------------------------------------------------------------------------------1---------------11-111----------111-----1------------111-----1-211--112111----------1-11211111121-1--1--------11-11---2122---11111111-22--1-1----------------------------------11---1------------------------111------------1-------11---------------11---11---1-------1-211--1----1-111111----------------121--11--2--------------------------------1-------1---1---111-111-------111-1--11-------------1-------------------1111-----------------------------1-------1---1-----1-------11--------------------------------------------------------------11--11------------------------------------------------- ---------------------------------------------------------------------------------------------1---------------------------------------------------------------1---1--------------------------------1-11- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 241 STR:RPRED 82.8 SQ:SECSTR ####EEEccccccEEcHHHHHHHHTccccccHHHHHHHHHHHHHHHHTcccccHHHHHHHHHHHTTcccEEEEEccTTcEEEcccEEEEEEEccGGGTTHHHHTHHHHHTTHHHHHHHHHHHHHHHHHHHHHHHHHcccTTGGGcEEEccTHHHHTccTTcccHHHHHHHHHHHTTTccccccTHHHHHHHHHTcccccccccccHHHHHHHHHTccEEEcccccEEEEHHHHHHHHHHcTTcEE############################################## DISOP:02AL 1-1,3-3,287-292| PSIPRED ccccccccccHHHHHHHHHHHHcccccccEEEEEEEccccEEEEEEEEccccHHHHHHHHHHHHHHcccEEEEEcccccccccccEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEcccccccccHHHHHHHHHcccccccccccccEEEEHHHHHHcccHHHHHHHHHHHcccccEEEEEEccHHHHHHHHHccccEEEEccccHHHHHHHHHHHHccccccEEEEcccccccHHHHHHHcccEEEEEccccccccEEEEEEEEEccccc //