[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38439.1
DDBJ      :             protein of unknown function, zinc metallopeptidase putative
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  326/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.92.1
:319 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   94->304 3dwbA PDBj 6e-16 13.7 %
:RPS:SCOP  114->244 1eb6A  d.92.1.12 * 2e-12 9.0 %
:RPS:PFM   64->314 PF04228 * Zn_peptidase 2e-67 54.2 %
:HMM:PFM   15->314 PF04228 * Zn_peptidase 7.7e-102 47.6 288/292  
:BLT:SWISS 85->314 YPFJ_ECOLI 2e-53 49.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38439.1 GT:GENE ABE38439.1 GT:PRODUCT protein of unknown function, zinc metallopeptidase putative GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 1359877..1360836 GB:FROM 1359877 GB:TO 1360836 GB:DIRECTION + GB:PRODUCT protein of unknown function, zinc metallopeptidase putative GB:PROTEIN_ID ABE38439.1 GB:DB_XREF GI:91682137 InterPro:IPR007343 LENGTH 319 SQ:AASEQ MVRTARRREPEEKLMRDDDFRRSDNIDDRREGGGGGGGGFGFPMGGGGLGIGTIVVLGLVGWAFGIDPRLLISGAEVLTGGAPTQQSERASPGKQGAPTDEMGSMISGVLGEIDDRWTEIFKANGQTYVGPRIVLFRNSTNGGRCGMAQSAMGPFYCPPDKQIYIDTNFFKQVETRFKGCSGSACRFTAAYIIAHEAGHHVQNLLGILPRVTRLQEQAGSKSESNALQVRVELQADCLSGVWVNREQKKRPNFLEEGDIDAALTTASAIGDDTLQRKAGREVVPDSFTHGSAEQRKRWFMTGYQQGTVQACNTFAAEKL GT:EXON 1|1-319:0| BL:SWS:NREP 1 BL:SWS:REP 85->314|YPFJ_ECOLI|2e-53|49.3|217/287| SEG 16->30|rdddfrrsdniddrr| SEG 32->61|ggggggggfgfpmgggglgigtivvlglvg| RP:PDB:NREP 1 RP:PDB:REP 94->304|3dwbA|6e-16|13.7|204/660| RP:PFM:NREP 1 RP:PFM:REP 64->314|PF04228|2e-67|54.2|236/263|Zn_peptidase| HM:PFM:NREP 1 HM:PFM:REP 15->314|PF04228|7.7e-102|47.6|288/292|Zn_peptidase| RP:SCP:NREP 1 RP:SCP:REP 114->244|1eb6A|2e-12|9.0|122/177|d.92.1.12| OP:NHOMO 336 OP:NHOMOORG 326 OP:PATTERN -------------------------------------------------------------------- -12-211111111111111-11--1111111111112111-1-11111111-111111----1-222--13----------------------------11111-111-1------------------1-----------------2------------------------------------111-------------------------------------11--------1---------------------------------------------11-1---1-------------1111111111111-11---1111--------------------------11----------------------1-11--1-----11111111111111111111-111-1111111111--11111111111111-1--11-1----1------------1---------------------------------11111-1111111111-----11--------11-1111--1111111111111-1111--------------1111------1------------1------1--111--1---------------------1--1-----------1111---111--1-------11---------11---111111111111-1111111111111111111111----1111111111111111111121111--111111111111------------------111111--------111111-11111-11111111111111111-------------------1----------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 223 STR:RPRED 69.9 SQ:SECSTR ###########################################################################ccccTTcGGcccccccc#EEEccGGHHHHHHHTTccccTTcHHHHHHHHHHHHHHHHHTTTTccccTTcccccTTccccEEETTTTEEEEEGGGccTTTccTETccHHHHHHTHHHHHHHHHHHTTcTTGGGccTTcccccccccHHHHHHHHHHHHHHHHHHTTcccccccccTTTTHHHHHHHHHHHHHHHHHHHHHHHccccccccccccH#####HHHHHHHHHH############### DISOP:02AL 1-14,27-33,74-103,211-227| PSIPRED ccccHHHccHHHHHHHHHHHHHcccccHHHHccccccccccccccccccHHHHHHHHHHHHHHHcccHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEccccccccccccHHHccccccccccEEEEcHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHccccccccccccccc //