[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38440.1
DDBJ      :             Molybdenum cofactor biosynthesis protein
Swiss-Prot:             

Homologs  Archaea  55/68 : Bacteria  442/915 : Eukaryota  55/199 : Viruses  0/175   --->[See Alignment]
c.57.1
:183 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   11->167 1r2kB PDBj 5e-36 49.0 %
:RPS:PDB   14->150 1eavA PDBj 2e-21 30.5 %
:RPS:SCOP  9->173 1mkzA  c.57.1.1 * 4e-40 45.5 %
:HMM:SCOP  12->166 2g2cA1 c.57.1.1 * 1.5e-47 41.8 %
:RPS:PFM   29->147 PF00994 * MoCF_biosynth 1e-04 34.2 %
:HMM:PFM   17->158 PF00994 * MoCF_biosynth 2.2e-40 40.7 135/144  
:BLT:SWISS 11->167 MOAB_ECOLI 4e-39 49.0 %
:PROS 75->88|PS01078|MOCF_BIOSYNTHESIS_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38440.1 GT:GENE ABE38440.1 GT:PRODUCT Molybdenum cofactor biosynthesis protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 1360930..1361481 GB:FROM 1360930 GB:TO 1361481 GB:DIRECTION + GB:PRODUCT Molybdenum cofactor biosynthesis protein GB:PROTEIN_ID ABE38440.1 GB:DB_XREF GI:91682138 InterPro:IPR001453 InterPro:IPR008284 LENGTH 183 SQ:AASEQ MMASVEQPKTFIPLNIAVLTVSDTRALGDDKSGATLVDRLTTAGHRLASREIVPDDIEAIRAVVRRWIADPGIDAIITTGGTGFTGRDVTPEAIEPLFEKRMDGFSIVFQMMSYGKIGTSTIQSRATAGVAGATYIFCLPGSPGACRDGWDGILAAQLDYRTRPCNFVEIMPRLDEHLRRDKA GT:EXON 1|1-183:0| BL:SWS:NREP 1 BL:SWS:REP 11->167|MOAB_ECOLI|4e-39|49.0|157/170| PROS 75->88|PS01078|MOCF_BIOSYNTHESIS_1|PDOC00828| SEG 78->86|ttggtgftg| BL:PDB:NREP 1 BL:PDB:REP 11->167|1r2kB|5e-36|49.0|155/166| RP:PDB:NREP 1 RP:PDB:REP 14->150|1eavA|2e-21|30.5|131/154| RP:PFM:NREP 1 RP:PFM:REP 29->147|PF00994|1e-04|34.2|111/143|MoCF_biosynth| HM:PFM:NREP 1 HM:PFM:REP 17->158|PF00994|2.2e-40|40.7|135/144|MoCF_biosynth| GO:PFM:NREP 1 GO:PFM GO:0006777|"GO:Mo-molybdopterin cofactor biosynthetic process"|PF00994|IPR001453| RP:SCP:NREP 1 RP:SCP:REP 9->173|1mkzA|4e-40|45.5|165/170|c.57.1.1| HM:SCP:REP 12->166|2g2cA1|1.5e-47|41.8|153/0|c.57.1.1|1/1|Molybdenum cofactor biosynthesis proteins| OP:NHOMO 611 OP:NHOMOORG 552 OP:PATTERN ------111111111111111111211211121-11111111111111111111-111111--11--- 111-1----------11--------1------1-------11111----------------------1111-------111111-122-------------1----11-----------------1111111111111111---112211111-1--1111111--11111------------11111---1-11111111111111111111-1111-111--11111111-11111111111111111111-------1---11-1-------------------------------------------------------11-111111111111-1---1111--1-1--11111-1--11111-11--1112112------111111211111------------11212211111-11111111111121121111111111111111111111-1-11-----------------------------11111-11111----------------------------------1-11-----------------------------111111--11----11111112111111-111111111111----------111-1112212111-1-12111111211112122122----111------1111-111111111111-111111111111111111111111---111111111111111111111111-----------------1---------11111---------------11111111111122222221122221111-------------11111111111--11112111------1-------------------------------------------------1----1- ----111-------1--1--------1---------------------1---1------------------------------------121-1-1------1111------223-------1-2--2-35212-2----2-1--1-11----2-111----1--1-2---111---------111-21-11-1-111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 157 STR:RPRED 85.8 SQ:SECSTR ##########cccEEEEEEEEcHHHHTTcccHHHHHHHHHHHTcEEEEEEEEEcccHHHHHHHHHHHHHTTcccEEEEEccccccTTccHHHHHHTTccEEcHHHHHHHHHHTTcGGccEGGGccccEEEETHTEEEEEcccHHHHHHHHHHHHcTTccTTcccccc################ DISOP:02AL 1-12,176-176,178-184| PSIPRED cccccccccccccEEEEEEEEcccccHHHcccHHHHHHHHHHcccEEEEEEEEcccHHHHHHHHHHHHHcccccEEEEccccccccccccHHHHHHHHHccccHHHHHHHHHHcccccccEEEEEEEEEEEccEEEEEccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHcccccc //