[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38453.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  52/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.5
:75 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->75 2hfvA PDBj 3e-30 76.0 %
:RPS:SCOP  1->75 2hfvA1  d.58.5.5 * 3e-23 76.0 %
:RPS:PFM   3->67 PF09413 * DUF2007 8e-13 58.5 %
:HMM:PFM   2->69 PF09413 * DUF2007 3.2e-35 58.8 68/68  
:PROS 1->4|PS00228|TUBULIN_B_AUTOREG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38453.1 GT:GENE ABE38453.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 1375269..1375496 GB:FROM 1375269 GB:TO 1375496 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABE38453.1 GB:DB_XREF GI:91682151 LENGTH 75 SQ:AASEQ MRELVRTNDVVLISAIGALMDGAQIHYLVMDQNMSILEGSVGVIPRRVLVHPDDLSSARQVLTDAGLAHELRTDE GT:EXON 1|1-75:0| PROS 1->4|PS00228|TUBULIN_B_AUTOREG|PDOC00200| BL:PDB:NREP 1 BL:PDB:REP 1->75|2hfvA|3e-30|76.0|75/97| RP:PFM:NREP 1 RP:PFM:REP 3->67|PF09413|8e-13|58.5|65/68|DUF2007| HM:PFM:NREP 1 HM:PFM:REP 2->69|PF09413|3.2e-35|58.8|68/68|DUF2007| RP:SCP:NREP 1 RP:SCP:REP 1->75|2hfvA1|3e-23|76.0|75/75|d.58.5.5| OP:NHOMO 52 OP:NHOMOORG 52 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-111111111111111111-111111111-1--11111-1111111---1-11-11111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 75 STR:RPRED 100.0 SQ:SECSTR EEEEEEEccHHHHHHHHHHHHHTTccEEcccccccccccccccccEEEEEEGGGHHHHHHHHHHTTccccccccc DISOP:02AL 1-1,71-76| PSIPRED cccEEccccHHHHHHHHHHHccccccEEEEEccccEEcccHHEEEEHHcccHHHHHHHHHHHHHcccHHHHHccc //