[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38471.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  76/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.4.5d.113.1
:326 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   218->315 3gz6A PDBj 9e-04 26.8 %
:RPS:SCOP  261->320 2fb1A1  a.4.5.68 * 2e-19 31.7 %
:HMM:SCOP  21->154 2fb1A2 d.113.1.6 * 3.5e-14 30.7 %
:HMM:SCOP  245->320 2fb1A1 a.4.5.68 * 2.3e-23 51.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38471.1 GT:GENE ABE38471.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(1399096..1400076) GB:FROM 1399096 GB:TO 1400076 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE38471.1 GB:DB_XREF GI:91682169 LENGTH 326 SQ:AASEQ MSDKPSTGDSLPIPIEIGLTAAIVAIENNEPLILTASGGNNLIGLPYGPFDAISHRTLEIGLRAWVEEQTGLRLGYVEQLYTFGDRGRHARLGDTDVHVASIGYLALTRAVDNAAGATFEPWYRFFPWEDWRENRPEIIERDIIPELTAWAGQAEQADTARALARRDRVRLYFGIDGAQWDEERVLDRYELLYEAGLIEEARRDGRPAALSRAKVPPLGLAMRFDHRRILATAIARLRAKLKYRPVVFELLPPEFTLTELQHTVEAISGRHLHKQNFRRLVEAGALVEPTGEMSTRTGGRPAALFRFRREVLQERPAPGLRVRGRR GT:EXON 1|1-326:0| SEG 132->146|renrpeiierdiipe| SEG 157->171|adtaralarrdrvrl| SEG 227->239|rrilataiarlra| SEG 248->260|fellppeftltel| BL:PDB:NREP 1 BL:PDB:REP 218->315|3gz6A|9e-04|26.8|97/219| RP:SCP:NREP 1 RP:SCP:REP 261->320|2fb1A1|2e-19|31.7|60/76|a.4.5.68| HM:SCP:REP 21->154|2fb1A2|3.5e-14|30.7|127/0|d.113.1.6|1/1|Nudix| HM:SCP:REP 245->320|2fb1A1|2.3e-23|51.3|76/0|a.4.5.68|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 78 OP:NHOMOORG 77 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-----1111111111111----------1-11111111121-111111111111-1111----------11111111111-1-11-----------------------------------11111--------------------------------------1--------------1111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 97 STR:RPRED 29.8 SQ:SECSTR #########################################################################################################################################################################################################################TTccccTTHHHHHHHHHHHHHHHHHHccGGGGGccccccHHHHHHHHHHHTTccccHHHHHHHHHHHTcEEEEEEEEccc#cccEEEEEEcGGGGTcc########### DISOP:02AL 1-13,293-297,323-327| PSIPRED cccccccccccccEEEEEEEEEEEEEEcccEEEEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHcccccEEEEEHHHcccccccccccccEEEEEEEEEEEEEcccccccccccccccccccHHHccccHHHHHHHccHHHHHHcccHHHHHHHHHHHHcccEEEEEEEccccccHHHHHHHHHHHHHHHccccccccccccccccHHcccccccHHHHHHHHHHHHHHHHHHHEEEcccEEEccccccHHHHHHHHHHHHHcccccHHHHHHHHHHccccHHcccEEccccccccEEEcccHHHHHHcccccccccccc //