[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38484.1
DDBJ      :             FAD linked oxidase-like
Swiss-Prot:             

Homologs  Archaea  38/68 : Bacteria  594/915 : Eukaryota  186/199 : Viruses  0/175   --->[See Alignment]
d.145.1d.58.32
:489 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   67->269 2uuuC PDBj 2e-15 28.3 %
:RPS:PDB   15->489 1e8gA PDBj 7e-72 15.4 %
:RPS:SCOP  36->239 1w1oA2  d.145.1.1 * 7e-33 21.3 %
:RPS:SCOP  242->489 1f0xA1  d.58.32.2 * 5e-37 13.1 %
:HMM:SCOP  27->241 1f0xA2 d.145.1.1 * 1e-75 52.8 %
:HMM:SCOP  244->489 1e8gA1 d.58.32.1 * 2e-61 35.0 %
:RPS:PFM   68->201 PF01565 * FAD_binding_4 1e-16 41.4 %
:RPS:PFM   319->487 PF02913 * FAD-oxidase_C 7e-19 41.6 %
:HMM:PFM   240->488 PF02913 * FAD-oxidase_C 5.2e-57 29.5 241/249  
:HMM:PFM   67->203 PF01565 * FAD_binding_4 1.7e-38 43.0 135/138  
:BLT:SWISS 22->489 D2HDH_RAT 2e-81 38.5 %
:PROS 418->429|PS00213|LIPOCALIN
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38484.1 GT:GENE ABE38484.1 GT:PRODUCT FAD linked oxidase-like GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(1407976..1409445) GB:FROM 1407976 GB:TO 1409445 GB:DIRECTION - GB:PRODUCT FAD linked oxidase-like GB:PROTEIN_ID ABE38484.1 GB:DB_XREF GI:91682182 InterPro:IPR002345 InterPro:IPR004113 InterPro:IPR006094 LENGTH 489 SQ:AASEQ MGGRGQNQARRTARMNIANPPPIVALPPELIARFAALVGDKYAVTDPAELEAYVTEERNLYRGHSPLVLRPGSTAEIAAICKLASETRVALVPQGGNTGLVGGQTPLNGEIVISLKRMDNIREVDTSSNTMTVEAGVILQHAQERAASVDRLFPLSLGAQGSCTIGGNLSTNAGGTAALAYGLARDMALGLEVVLADGRILNLLSKLKKDNTGYDLRDLFIGAEGTLGIITAATLKLFPKPRAVETAFVGLQSPADALKLLGIAQAEAAGNLTSFELIAEIALDFSVRHGHNRDPLQSRHPWYVLIELSSMRDDARGALEAILERGFEEGVVVDAAIATSLTQQQAFWKLREEISPAQKPEGGSIKHDVSVPVAAVPQFIDEANAAVVGLIPGARPVPFGHLGDGNIHYNVTQPVDADKAAFLGRWHEVNTVVFAIVMRLGGSISAEHGIGVMKRDELPGVKDQTAIELMRAIKAMLDPQGIMNPGKVL GT:EXON 1|1-489:0| BL:SWS:NREP 1 BL:SWS:REP 22->489|D2HDH_RAT|2e-81|38.5|457/535| PROS 418->429|PS00213|LIPOCALIN|PDOC00187| SEG 173->184|aggtaalaygla| BL:PDB:NREP 1 BL:PDB:REP 67->269|2uuuC|2e-15|28.3|191/541| RP:PDB:NREP 1 RP:PDB:REP 15->489|1e8gA|7e-72|15.4|473/550| RP:PFM:NREP 2 RP:PFM:REP 68->201|PF01565|1e-16|41.4|133/139|FAD_binding_4| RP:PFM:REP 319->487|PF02913|7e-19|41.6|161/242|FAD-oxidase_C| HM:PFM:NREP 2 HM:PFM:REP 240->488|PF02913|5.2e-57|29.5|241/249|FAD-oxidase_C| HM:PFM:REP 67->203|PF01565|1.7e-38|43.0|135/138|FAD_binding_4| GO:PFM:NREP 4 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF01565|IPR006094| GO:PFM GO:0050660|"GO:FAD binding"|PF01565|IPR006094| GO:PFM GO:0003824|"GO:catalytic activity"|PF02913|IPR004113| GO:PFM GO:0050660|"GO:FAD binding"|PF02913|IPR004113| RP:SCP:NREP 2 RP:SCP:REP 36->239|1w1oA2|7e-33|21.3|197/206|d.145.1.1| RP:SCP:REP 242->489|1f0xA1|5e-37|13.1|222/237|d.58.32.2| HM:SCP:REP 27->241|1f0xA2|1e-75|52.8|212/0|d.145.1.1|1/1|FAD-binding domain| HM:SCP:REP 244->489|1e8gA1|2e-61|35.0|234/0|d.58.32.1|1/1|FAD-linked oxidases, C-terminal domain| OP:NHOMO 2270 OP:NHOMOORG 818 OP:PATTERN 22-1-13223433333113332131----111----------------13111-------12113-11 -2453--1----2-33333-332245434443333328B6134321121111143311--2352455432---------1-1311111-----1-------11-1-1111---------------1122222221266633----22222222222211122222232222-1-----1----22233--131122222222222222253111122234413--------2------------------------1111----11--21------------------------------------------------------3-121111111212-122211121-1-1--2-461121--42--1--1-321311411111227542254653544444443446-45644A4655316554459545876422144544564442222222232221226-----------------------------1146115444466686735566558756555485767771244355544636348224321-34222221222244415823334453554-212112222554544232--1111111122222222211111441--13---3-21------1-------2-1----4224------21111113213334333-233344334323433333112111111111111111111111121121111--1--------------1--111----32335---11--1111---111111113525-444444333343422332----2-----11-111111112222222222232222112-221111----------1--------------------------11---2---421 ----332-741-2422444353455543333333333534444233344456684334344423324334224243313334446312-47443323332322433-323733253321-133284152BQ5-425121-322311313231-2324155622332132233524222182221131-63312264532 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 485 STR:RPRED 99.2 SQ:SECSTR ####TcccccccHHccccccTccHHHHHHHHHHHHHHHcGGGEEEcccccccccccccccTcccccEEEccccHHHHHHHHHHHHHHTccEEEEcccccTTTTTTccTTcEEEEcTTTccEEEEETTTTEEEEcTTccHHHHHHHHHHTTcTTTEEccccccTTccHHHHHHTTcccccTTccTGGGEEEEEEEETTccEEEcTTccGGGccccTTTTTcGGcccccEEEEEEEEEcEEccccEEEEEEEEccTTHHHHHHHHHHHHHHTTcccccEEEEHHHHHHHHccGGGTcccccccHHHHHHHHHHHTcccEEEEEEEEHHHHTTcTTcEEEcGGGccTTcHHHHHHHHTTTccccGGGEccEEcccHHHHHHHHHHHHHHHHHETHTccccEEEEEccccEEEEEEEEEETTcHHHHHHHHHHHHHHHHHHHHTTcccccccGGGHHHHHHHTcHHHHHHHHHHHHHHHHHcTTccccTTGGG DISOP:02AL 1-25| PSIPRED cccccccccccccccccccccccccccHHHHHHHHHHcccccEEccHHHHHHHHccccccccccccEEEEcccHHHHHHHHHHHHHcccEEEEEccccccccccccccccEEEEccccccEEEEEccccEEEEEccccHHHHHHHHHHcccEEEEcccccccccEEHHccccccHHHHHHHHHHHHEEEEEEEEcccccEEEEccccccccccccHHHHHHccccccEEEEEEEEEEEEccccEEEEEEEEccHHHHHHHHHHHHHHcccccEEEHHHHHHHHHHHHHHHccccccccccccEEEEEEccccHHHHHHHHHHHHHHHHcccccEEEEcccHHHHHHHHHHHHHHHHHHcccccEEEEEEEEcHHHHHHHHHHHHHHHHHcccccEEEEEEEEccccEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHcccEEEccccccHHHHHHHHHccHHHHHHHHHHHHHHcccccccccccc //