[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38507.1
DDBJ      :             ErfK/YbiS/YcfS/YnhG
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  279/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
b.160.1
:224 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   139->201 1y7mA PDBj 2e-06 43.1 %
:RPS:SCOP  69->202 1zatA1  b.160.1.1 * 4e-25 23.9 %
:HMM:SCOP  63->203 1y7mA1 b.160.1.1 * 2.6e-31 40.9 %
:RPS:PFM   70->200 PF03734 * YkuD 6e-07 39.0 %
:HMM:PFM   71->201 PF03734 * YkuD 1.7e-19 28.2 110/116  
:BLT:SWISS 70->203 ERFK_ECOLI 2e-16 37.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38507.1 GT:GENE ABE38507.1 GT:PRODUCT ErfK/YbiS/YcfS/YnhG GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(1430936..1431610) GB:FROM 1430936 GB:TO 1431610 GB:DIRECTION - GB:PRODUCT ErfK/YbiS/YcfS/YnhG GB:PROTEIN_ID ABE38507.1 GB:DB_XREF GI:91682205 InterPro:IPR005490 LENGTH 224 SQ:AASEQ MASLGKKLGLLVCAGLLLSACTQTTYQETSSTVFKPRDKELLAKVSYVKTPTPEAFRRAIVDYHRKETPGSIVVDSDNHYLYYVQDGGKAIRYGITVGEEAMAWSGIAKVGAMAEWPAWHPTPSEISRLGVPRFVAPGPDNPMGSRAIYLYSGGKDTLFRIHGTNQPEYIGASISSGCIRMTNEDVIDLYNRVKMGAIVVVLEPKHGDSPYNSKMALQGGGSTL GT:EXON 1|1-224:0| BL:SWS:NREP 1 BL:SWS:REP 70->203|ERFK_ECOLI|2e-16|37.2|129/310| SEG 4->18|lgkklgllvcaglll| BL:PDB:NREP 1 BL:PDB:REP 139->201|1y7mA|2e-06|43.1|58/161| RP:PFM:NREP 1 RP:PFM:REP 70->200|PF03734|6e-07|39.0|118/136|YkuD| HM:PFM:NREP 1 HM:PFM:REP 71->201|PF03734|1.7e-19|28.2|110/116|YkuD| RP:SCP:NREP 1 RP:SCP:REP 69->202|1zatA1|4e-25|23.9|117/126|b.160.1.1| HM:SCP:REP 63->203|1y7mA1|2.6e-31|40.9|115/0|b.160.1.1|1/1|L,D-transpeptidase catalytic domain-like| OP:NHOMO 826 OP:NHOMOORG 280 OP:PATTERN -------------------------------------------------------------------- -1-----------------------------------------------------------------------------------1-------------------------------------------------------------111--1--11-1-21---1-1122---------------------1-111111111111111-----1111111-----------1---------------------------------------------------------------------------------------------------111-1---11----------------1-1------------11----11111168B9966789A9855554454548-BEABF8AA89--677598A9898867---A136566322------------------------------------------------------------------------------------------------------------111-----11-------------1-----212-1121122-2--2--------------------------11331-1------1111111111111111111--11111------43221314444444444-4444444444444444444444221-1443444444443434424344443111-1-11111111---------11112-11---------------------111111-111111-11-1--1111-------------11111111111----------------1-------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 58 STR:RPRED 25.9 SQ:SECSTR ##########################################################################################################################################ccGGGTTEEEEEccTT####cEEEccccGGGTTcEEEcccEE#cHHHHHHHHHHccTTcEEEE####################### DISOP:02AL 1-5,219-225| PSIPRED cccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHccccccccccEEEEEEccccEEEEEEccEEEEEEEEEEccccccccEEEEEEEEEEcccccccHHHHcccccccccccccccccccEEEEEEccccccEEEEEccccccccccccccccEEccHHHHHHHHHHcccccEEEEEccccccccccccEEEccccccc //