[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38516.1
DDBJ      :             molybdopterin synthase subunit MoaE
Swiss-Prot:             

Homologs  Archaea  10/68 : Bacteria  351/915 : Eukaryota  6/199 : Viruses  0/175   --->[See Alignment]
d.41.5
:155 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   25->140 1nvjD PDBj 2e-24 47.3 %
:RPS:SCOP  27->140 1fm0E  d.41.5.1 * 2e-20 48.6 %
:HMM:SCOP  3->152 1fm0E_ d.41.5.1 * 2.5e-51 42.3 %
:RPS:PFM   31->124 PF02391 * MoaE 2e-16 43.6 %
:HMM:PFM   7->123 PF02391 * MoaE 6e-31 32.2 115/117  
:BLT:SWISS 2->139 MOAE_BRUSU 3e-31 47.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38516.1 GT:GENE ABE38516.1 GT:PRODUCT molybdopterin synthase subunit MoaE GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(1441737..1442204) GB:FROM 1441737 GB:TO 1442204 GB:DIRECTION - GB:PRODUCT molybdopterin synthase subunit MoaE GB:PROTEIN_ID ABE38516.1 GB:DB_XREF GI:91682214 InterPro:IPR003448 LENGTH 155 SQ:AASEQ MTVPVTIRIQEADFDIAAEIAAMTAGRTDIGAVVSFSGICRGAEGDDAVAALTLEHYPGMAEDEIGRHAAAAVTRWPVTALTIVHRVGRMRPGDNIVLVLAASAHRQAAFSAAEFLMDYLKANAPFWKREERAGGTRWVEAHDRDDAAAARWDKD GT:EXON 1|1-155:0| BL:SWS:NREP 1 BL:SWS:REP 2->139|MOAE_BRUSU|3e-31|47.1|136/163| SEG 11->22|eadfdiaaeiaa| SEG 101->113|aasahrqaafsaa| SEG 141->154|ahdrddaaaarwdk| BL:PDB:NREP 1 BL:PDB:REP 25->140|1nvjD|2e-24|47.3|112/135| RP:PFM:NREP 1 RP:PFM:REP 31->124|PF02391|2e-16|43.6|94/117|MoaE| HM:PFM:NREP 1 HM:PFM:REP 7->123|PF02391|6e-31|32.2|115/117|MoaE| GO:PFM:NREP 1 GO:PFM GO:0006777|"GO:Mo-molybdopterin cofactor biosynthetic process"|PF02391|IPR003448| RP:SCP:NREP 1 RP:SCP:REP 27->140|1fm0E|2e-20|48.6|107/142|d.41.5.1| HM:SCP:REP 3->152|1fm0E_|2.5e-51|42.3|149/149|d.41.5.1|1/1|Molybdopterin synthase subunit MoaE| OP:NHOMO 380 OP:NHOMOORG 367 OP:PATTERN --------------------------------------1111-11-1-1-----1--1---------- 1--------------------------------------------------------------------1------------1-----------------------------------------------1----111111----------------1-1111---11--1------------1--11------11111--------1----------111---1-------------------------------------------------------------------------------------------------------------------------------------------------------1111-----111111111111111111111111-11111111111-11111111111111121111111111111111111111-1111------------------------------1111-1111122212211111221111111121111111111111111111111111111111----------111------------------------11-11----------------------------111112111-1-11111111111111111111----1-1------11111111111111111-111111111111111111111111111111111111111111111111111--111111111111---1---------11111111111111111111----------1111111221111111111---------111111111111111--------------111-------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------11--2-11------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 116 STR:RPRED 74.8 SQ:SECSTR ########################TccTTccEEEEEEEEccccccccccccEEEEccTTHHHHHHHHHHHHHHHHccEEEEEEEEEcEEEcTTcEEEEEEEEEccHHHHHHHHHHHHHHHHHHcccEEEEccTTccEEEE############### DISOP:02AL 1-3,149-149,153-156| PSIPRED ccccEEEEEEEcccHHHHHHHHHHcccccccEEEEEEEEEccccccccEEEEEEEEccHHHHHHHHHHHHHHHHHcccEEEEEEEEEEccccccEEEEEEEEccHHHHHHHHHHHHHHHHHHcccEEEEEEEccccEEEEEcccccHHHHccccc //