[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38520.1
DDBJ      :             putative outer membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  51/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
f.4.1
:207 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   41->207 1bxwA PDBj 1e-06 17.1 %
:RPS:SCOP  52->196 1qj8A  f.4.1.1 * 5e-10 19.1 %
:HMM:SCOP  41->207 1g90A_ f.4.1.1 * 2.4e-29 31.1 %
:HMM:PFM   124->207 PF01389 * OmpA_membrane 4e-05 24.1 83/200  
:BLT:SWISS 41->207 ROPB_RHILV 4e-24 36.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38520.1 GT:GENE ABE38520.1 GT:PRODUCT putative outer membrane protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 1445629..1446252 GB:FROM 1445629 GB:TO 1446252 GB:DIRECTION + GB:PRODUCT putative outer membrane protein GB:PROTEIN_ID ABE38520.1 GB:DB_XREF GI:91682218 LENGTH 207 SQ:AASEQ MRKFAMAAATILAAGASTAQAADMGYYGSRTPYTVNQPLNAFSWAGPYLGGNLGYSFGNVTNSITKPSGFNGGVQGGYNWQSGNIVFGLEGDIQFSTADDTFAPYKFSNPWFGTARGRVGYAMNDLLIYATGGFAFGQLKGERLLSTESHSSAGWTVGAGAEFAFAPKLSAKVEYLYGSLSTNNFFITGAPNGYNFGVVRAGINYHF GT:EXON 1|1-207:0| BL:SWS:NREP 1 BL:SWS:REP 41->207|ROPB_RHILV|4e-24|36.7|166/211| SEG 5->22|amaaatilaagastaqaa| RP:PDB:NREP 1 RP:PDB:REP 41->207|1bxwA|1e-06|17.1|164/172| HM:PFM:NREP 1 HM:PFM:REP 124->207|PF01389|4e-05|24.1|83/200|OmpA_membrane| RP:SCP:NREP 1 RP:SCP:REP 52->196|1qj8A|5e-10|19.1|141/148|f.4.1.1| HM:SCP:REP 41->207|1g90A_|2.4e-29|31.1|161/0|f.4.1.1|1/1|OMPA-like| OP:NHOMO 268 OP:NHOMOORG 52 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----25IBF6877689755575775775-3222363F46--43322223323258-----------------------------------------------------------------------------------------------------------------1-------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 164 STR:RPRED 79.2 SQ:SECSTR ########################################cccTTcEEEEEEEEEEccccccccccccEEEEEEEEEEEEETTEEEEEEEEEEEEcccccccccccEEEEEEEEEEEEEEEccccEEEEEEEEEEEEEEEEccTTccEEEEEEEEEEEEEEEEEccccEEEEEEEEEEccccccccccccccccEE###EEEEEEEE DISOP:02AL 1-6| PSIPRED cccHHHHHHEEEEccccccccccccccccccccccccccccccccccEEEEEEEEEEEcccccccccccEEEEEEEEEEEccccEEEEEEEEEEEccccccccEEEEEccEEEEEEEEEEEEEccccEEEEEEEEEEEEEEcccccccccccEEEEEEEEEEEEccccEEEEEEEEEEEccccEEEEccccccccEEEEEEEEEEEc //