[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38538.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  10/68 : Bacteria  225/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.350.1
:210 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   28->64 1a0sP PDBj 6e-04 43.2 %
:RPS:PDB   84->152 2ekyC PDBj 2e-07 10.3 %
:RPS:SCOP  30->130 2h7aA1  d.350.1.1 * 6e-05 11.1 %
:RPS:PFM   87->130 PF04055 * Radical_SAM 2e-04 50.0 %
:HMM:PFM   45->122 PF04055 * Radical_SAM 2.5e-08 35.1 74/166  
:BLT:SWISS 2->209 Y1189_HAEIN 4e-15 34.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38538.1 GT:GENE ABE38538.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(1465520..1466152) GB:FROM 1465520 GB:TO 1466152 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE38538.1 GB:DB_XREF GI:91682236 LENGTH 210 SQ:AASEQ MSYAVKEIFLTLQGEGAHAGRASVFCRFAGCNLWTGREQDRDQAACRFCDTDFVGTDGTLGGRYTDAGELAGAIAAQWAGAELDRYVVITGGEPLLQLDAELIAALQKQGFAIGVETNGTIEPPPGIDWLCVSPKAGAELRVKRGNELKLVYPQPGAMPEQFAALDFERFSLQPMDGPARDEHTRLAIAYCLRHPQWRLSVQTHKTIGIR GT:EXON 1|1-210:0| BL:SWS:NREP 1 BL:SWS:REP 2->209|Y1189_HAEIN|4e-15|34.2|184/211| SEG 67->81|agelagaiaaqwaga| BL:PDB:NREP 1 BL:PDB:REP 28->64|1a0sP|6e-04|43.2|37/413| RP:PDB:NREP 1 RP:PDB:REP 84->152|2ekyC|2e-07|10.3|68/99| RP:PFM:NREP 1 RP:PFM:REP 87->130|PF04055|2e-04|50.0|44/164|Radical_SAM| HM:PFM:NREP 1 HM:PFM:REP 45->122|PF04055|2.5e-08|35.1|74/166|Radical_SAM| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF04055|IPR007197| GO:PFM GO:0051536|"GO:iron-sulfur cluster binding"|PF04055|IPR007197| RP:SCP:NREP 1 RP:SCP:REP 30->130|2h7aA1|6e-05|11.1|90/109|d.350.1.1| OP:NHOMO 239 OP:NHOMOORG 236 OP:PATTERN ------1--------1-----11-1--1--1------------11--1-------------------- --1--------------------------------------11-1-------------------------------------------1111-111------111--1-1-------------------------------------11---1--1111----11---------1-----1---------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-11111-----1111111111111------------11111111-111------------11-11----------11111111111111----------------111---------------12111111111111111111112111111111111111111-11--11111111---1-1111111111----------------1111---------11-1---------11--------------1-----11--1--111-121111111111111-111----11-------11-1111------------------------------1-11111-1111111111111111--------1----------------------------1111111111111-1--1----------------1---------------------1-1----------------------------1-------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 105 STR:RPRED 50.0 SQ:SECSTR ###########################GTTcEEEEEEEEcTTcEEEGGGTEEEEccEEEEEEEE###################EEEEEEEccccccHHHHHHHHHHTTcccEEEEccccEE#EEEEHHHHHHHHHHHHHHHHTTccEEEEEE########################################################## PSIPRED ccEEEEEEEccccccccccccEEEEEEccccccccccccccccccccccccccccccccccccEEccHHHHHHHHHHHcccccccEEEEEccHHHHHHHHHHHHHHHHcccEEEEEccccccccccccEEEEccccccHHHHHcccEEEEEEccccHHHHHHHHcccccEEEEcccccccHHHHHHHHHHHHHccccEEEEEEEHccccc //