[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38546.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  31/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:136 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   36->56 PF10979 * DUF2786 0.00092 38.1 21/43  
:BLT:SWISS 47->127 17KD_RICBR 5e-10 32.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38546.1 GT:GENE ABE38546.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 1472288..1472698 GB:FROM 1472288 GB:TO 1472698 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABE38546.1 GB:DB_XREF GI:91682244 LENGTH 136 SQ:AASEQ MIAILMGPGLGGCSVGGKDAAFAQMESNDFTGSIRALAPSSDNGPTEADLAMARIAASDVLTKGDKDSSQPWENPATGARGSVTPIAAAYTSDGQSCRDFLASYVKDRSESWMQGAACRSAQGHWEIRSLKPWRRS GT:EXON 1|1-136:0| BL:SWS:NREP 1 BL:SWS:REP 47->127|17KD_RICBR|5e-10|32.1|81/159| HM:PFM:NREP 1 HM:PFM:REP 36->56|PF10979|0.00092|38.1|21/43|DUF2786| OP:NHOMO 31 OP:NHOMOORG 31 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111111111111-1-11111-11111111----------------11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 38-47,135-137| PSIPRED cHHHHHHHHHHHHHcccccccEEEEEHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHccccccEEEEEccccccEEEEEEccccccccccEEEEEEEEEEEccEEEEEEEEEEEcccccEEEEEEcccccc //