[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38550.1
DDBJ      :             Enoyl-[acyl-carrier-protein] reductase (NADH)
Swiss-Prot:             

Homologs  Archaea  10/68 : Bacteria  721/915 : Eukaryota  125/199 : Viruses  0/175   --->[See Alignment]
c.2.1
:272 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->259 3grkB PDBj e-102 71.8 %
:RPS:PDB   5->259 2b35A PDBj 5e-32 23.9 %
:RPS:SCOP  6->259 1c14A  c.2.1.2 * 3e-39 50.8 %
:HMM:SCOP  9->261 1uh5A_ c.2.1.2 * 4.3e-64 28.3 %
:RPS:PFM   14->181 PF00106 * adh_short 4e-10 28.4 %
:HMM:PFM   29->180 PF00106 * adh_short 1.8e-11 24.0 146/167  
:BLT:SWISS 1->272 FABI1_RHIME e-114 73.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38550.1 GT:GENE ABE38550.1 GT:PRODUCT Enoyl-[acyl-carrier-protein] reductase (NADH) GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION 1475523..1476341 GB:FROM 1475523 GB:TO 1476341 GB:DIRECTION + GB:PRODUCT Enoyl-[acyl-carrier-protein] reductase (NADH) GB:PROTEIN_ID ABE38550.1 GB:DB_XREF GI:91682248 InterPro:IPR002347 LENGTH 272 SQ:AASEQ MVTDSGLMHGKRGVILGVANNRSIAWGIAKACRAHGAEIALTWQGDALKKRVTPLAAELEGILVGHCDVTEPATIDAVFDELKAKWGKIDFVVHAIAFSDKDQLDGRYVETTADNFSKTMLISCYSLTAIAQRAEKLMPDGGSILTLTYYGAEKWMPHYNVMGVAKAALEASVRYLAADLGEKNIRVNAISAGPIKTLAASGIGDFRYILKWNEYNSPMRRTVTIEEVGDSALYLLSGLSRGVTGEVHHVDCGYHVVGMKRPDAPDITLAKD GT:EXON 1|1-272:0| BL:SWS:NREP 1 BL:SWS:REP 1->272|FABI1_RHIME|e-114|73.9|272/272| BL:PDB:NREP 1 BL:PDB:REP 6->259|3grkB|e-102|71.8|252/252| RP:PDB:NREP 1 RP:PDB:REP 5->259|2b35A|5e-32|23.9|251/253| RP:PFM:NREP 1 RP:PFM:REP 14->181|PF00106|4e-10|28.4|162/169|adh_short| HM:PFM:NREP 1 HM:PFM:REP 29->180|PF00106|1.8e-11|24.0|146/167|adh_short| GO:PFM:NREP 2 GO:PFM GO:0008152|"GO:metabolic process"|PF00106|IPR002198| GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00106|IPR002198| RP:SCP:NREP 1 RP:SCP:REP 6->259|1c14A|3e-39|50.8|254/256|c.2.1.2| HM:SCP:REP 9->261|1uh5A_|4.3e-64|28.3|251/0|c.2.1.2|1/1|NAD(P)-binding Rossmann-fold domains| OP:NHOMO 2132 OP:NHOMOORG 856 OP:PATTERN -------1-------1--------1--1---1---------------1--------------211-1- 25614--1--1-1-6A644-45113B444443789939A8332911-111---3-111--32315156232---------112112222222-2--1--327136B571322222221112222121223322331122112223124112211111111111121243811111111121113331211-513222222222222222552233222335425222222222111111111111111111211-11--11-1-1111--1111--111--------------------------------------------1-1132221111111--111-1---21-11----------12----1-113-5622522222578752147465444444444434-365336345662844296788A4585241535556543422222222665212331111122211111111111111111111115151133324344282133335575333312448377414232314333451631331113211111111112233141-21111111111122211111112344--22221222221222222222122212222112-1-1---1212-1----211123--1-1121111111134211216664655566-66666656566655666625543111143544454454444443655444611-111111-11111112-----2222123512221121111111112334312122415545134132-2246441111111111----------1---1221211-------111-222211-------------------------------------1---1-111131 11------1-----2231143214444-------------------34112444241213121---11-1--1------1-22212-1-31-315-1122--1111-21-41-111-1---13--1-1-271-121-11-11141-1-1-1--11-123451-5124-12---131211L1111133371223131111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 272 STR:RPRED 100.0 SQ:SECSTR ccGGccTTTTcEEEEcccccTTcHHHHHHHHHHHTTcEEEEEEcccHHHHHHHHHTccccccEEEcccHHHHHHHHHHHHHHHcTTccEEEEEEccccccTTccccccGGGccHHHHHHHHHHHTHHHHHHHHHHGGGEEEEEEEEEEEcccccccTTTHHHHHHHHHHHHHHHHHHHHHHTTTcEEEEEEEcccccHHHHcHHHHHHHHHHHHHcTTcccTTccHHHHHHHHHHHTTccTTcccEEEEEcTTGGGcccHHHHHGccHHHHH DISOP:02AL 1-4,268-269,271-273| PSIPRED cccccccccccEEEEEcccccccHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHHHccccEEEEcccccccccccccHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEcccccccHHHHHcccHHHHHHHHHHcccccccccHHHHHHHHHHHHcHHHccccccEEEEccccEEEEcccccccccccccc //