[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Rhodopseudomonas palustris BisB5 (rpal2)
Gene : ABE38553.1
DDBJ      :             ATP-dependent Clp protease adaptor protein ClpS
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  413/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.45.1
:101 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   17->100 3gq1A PDBj 1e-17 42.9 %
:RPS:PDB   21->100 3dnjA PDBj 3e-23 43.8 %
:RPS:SCOP  11->99 1lzwA  d.45.1.2 * 9e-23 41.6 %
:HMM:SCOP  14->100 1mbxC_ d.45.1.2 * 3.5e-26 46.0 %
:RPS:PFM   19->78 PF02617 * ClpS 4e-12 46.7 %
:HMM:PFM   17->96 PF02617 * ClpS 5.6e-29 48.8 80/82  
:BLT:SWISS 1->101 CLPS2_RHILO 2e-44 77.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABE38553.1 GT:GENE ABE38553.1 GT:PRODUCT ATP-dependent Clp protease adaptor protein ClpS GT:DATABASE GIB00345CH01 GT:ORG rpal2 GB:ACCESSION GIB00345CH01 GB:LOCATION complement(1478343..1478648) GB:FROM 1478343 GB:TO 1478648 GB:DIRECTION - GB:PRODUCT ATP-dependent Clp protease adaptor protein ClpS GB:PROTEIN_ID ABE38553.1 GB:DB_XREF GI:91682251 InterPro:IPR003769 LENGTH 101 SQ:AASEQ MGKIVTKPSTKAKPKLERPKLHKVILVNDDFTPREFVVMILKAEFRMTEEQAYKVMLTAHQRGVCVVAVFTKDVAETKATRATDAGRVKGYPLLFTTEPEE GT:EXON 1|1-101:0| BL:SWS:NREP 1 BL:SWS:REP 1->101|CLPS2_RHILO|2e-44|77.2|101/101| BL:PDB:NREP 1 BL:PDB:REP 17->100|3gq1A|1e-17|42.9|84/85| RP:PDB:NREP 1 RP:PDB:REP 21->100|3dnjA|3e-23|43.8|80/80| RP:PFM:NREP 1 RP:PFM:REP 19->78|PF02617|4e-12|46.7|60/76|ClpS| HM:PFM:NREP 1 HM:PFM:REP 17->96|PF02617|5.6e-29|48.8|80/82|ClpS| GO:PFM:NREP 1 GO:PFM GO:0030163|"GO:protein catabolic process"|PF02617|IPR003769| RP:SCP:NREP 1 RP:SCP:REP 11->99|1lzwA|9e-23|41.6|89/91|d.45.1.2| HM:SCP:REP 14->100|1mbxC_|3.5e-26|46.0|87/87|d.45.1.2|1/1|ClpS-like| OP:NHOMO 439 OP:NHOMOORG 413 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------1--------------------------------------------11111---1--------------------------------------111--------------------------------------------------------------------------------------------------------------------------------------------11------------11------1-------------------------1-111111111112222212222211111111111-11111111221122222222222211111-1111111111111111121111111------------------------------1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-------1-111111111--11111111-1-------111-111111111111111111111111111111111--11111------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111--11-----111111111---------------11111111111111111111111111111---------111111111111111111111111211111-1-111111--------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 90 STR:RPRED 89.1 SQ:SECSTR ##########HHHHHTcccccEEEEEEccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHcEEEEEEEcHHHHHHHHHHHHHHHHHTTccccEEEEEc# DISOP:02AL 1-1,8-20,99-102| PSIPRED cccccccccHHHcccccccccEEEEEEccccccHHHHHHHHHHHHcccHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHHHHHHccccEEEEEcccc //